Recombinant Human Superoxide Dismutase [Cu-Zn], SOD1, Cu-Zn SOD (N-6His)

Contact us
Catalog number: CE19
Price: 471 €
Supplier: acr
Product name: Recombinant Human Superoxide Dismutase [Cu-Zn], SOD1, Cu-Zn SOD (N-6His)
Quantity: 0,1 mg
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human SOD1 is produced by our E, coli expression system and the target gene encoding Met1-Gln154 is expressed with a 6His tag at the N-terminus
Molecular Weight: 1 kD, 18
UniProt number: P00441
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Cu-Zn SOD (N-6His), Superoxide Dismutase [Cu-Zn] SOD1
Short name: Cu-Zn SOD (N-6His), Recombinant Superoxide Dismutase [Cu-Zn] SOD1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Cu-Zn antioxidant enzyme (N-6His), sapiens Superoxide Dismutase [Cu-Zn], soluble, superoxide dismutase 1, recombinant H
Alternative technique: rec
Alternative to gene target: ALS and ALS1 and HEL-S-44 and homodimer and hSod1 and IPOA and SOD, SOD1 and IDBG-1609 and ENSG00000142168 and 6647, Sod1 and IDBG-174662 and ENSMUSG00000022982 and 20655, chaperone binding, nuclei, soluble, this GO :0000187 and activation of MAPK activity and biological process this GO :0000302 and response to reactive oxygen species and biological process this GO :0000303 and response to superoxide and biological process this GO :0001541 and ovarian follicle development and biological process this GO :0001819 and positive regulation of cytokine production and biological process this GO :0001890 and placenta development and biological process this GO :0001895 and retina homeostasis and biological process this GO :0001975 and response to amphetamine and biological process this GO :0002262 and myeloid cell homeostasis and biological process this GO :0002576 and platelet degranulation and biological process this GO :0004784 and superoxide dismutase activity and molecular function this GO :0005507 and copper ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005758 and mitochondrial intermembrane space and cellular component this GO :0005759 and mitochondrial matrix and cellular component this GO :0005777 and peroxisome and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006749 and glutathione metabolic process and biological process this GO :0006801 and superoxide metabolic process and biological process this GO :0006879 and cellular iron ion homeostasis and biological process this GO :0006979 and response to oxidative stress and biological process this GO :0007283 and spermatogenesis and biological process this GO :0007566 and embryo implantation and biological process this GO :0007568 and aging and biological process this GO :0007569 and cell aging and biological process this GO :0007596 and blood coagulation and biological process this GO :0007605 and sensory perception of sound and biological process this GO :0007626 and locomotory behavior and biological process this GO :0008089 and anterograde axon car this GO transport and biological process this GO :0008090 and retrograde axon car this GO transport and biological process this GO :0008217 and regulation of blood pressure and biological process this GO :0008219 and cell death and biological process this GO :0008270 and zinc ion binding and molecular function this GO :0009408 and response to heat and biological process this GO :0010033 and response to organic substance and biological process this GO :0019226 and transmission of nerve impulse and biological process this GO :0019430 and removal of superoxide radicals and biological process this GO :0019899 and enzyme binding and molecular function this GO :0030141 and secretory granule and cellular component this GO :0030168 and platelet activation and biological process this GO :0030346 and protein phosphatase 2B binding and molecular function this GO :0031012 and extracellular matrix and cellular component this GO :0031045 and dense core granule and cellular component this GO :0031410 and cytoplasmic vesicle and cellular component this GO :0031667 and response to nutrient levels and biological process this GO :0032287 and peripheral nervous system myelin maintenance and biological process this GO :0032314 and regulation of Rac GTPase activity and biological process this GO :0032839 and dendrite cytoplasm and cellular component this GO :0032930 and positive regulation of superoxide anion generation and biological process this GO :0033081 and regulation of T cell differentiation in thymus and biological process this GO :0034465 and response to carbon monoxide and biological process this GO :0034599 and cellular response to oxidative stress and biological process this GO :0035865 and cellular response to potassium ion and biological process this GO :0040014 and regulation of multicellular organism growth and biological process this GO :0042493 and response to drug and biological process this GO :0042542 and response to hydrogen peroxide and biological process this GO :0042554 and superoxide anion generation and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043005 and neuron projection and cellular component this GO :0043025 and neuronal cell body and cellular component this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0043234 and protein complex and cellular component this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045471 and response to ethanol and biological process this GO :0045541 and negative regulation of cholesterol biosynthetic process and biological process this GO :0045859 and regulation of protein kinase activity and biological process this GO :0046620 and regulation of organ growth and biological process this GO :0046677 and response to antibiotic and biological process this GO :0046688 and response to copper ion and biological process this GO :0046716 and muscle cell cellular homeostasis and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048365 and Rac GTPase binding and molecular function this GO :0048538 and thymus development and biological process this GO :0048678 and response to axon injury and biological process this GO :0050665 and hydrogen peroxide biosynthetic process and biological process this GO :0051087 and chaperone binding and molecular function this GO :0051881 and regulation of mitochondrial membrane potential and biological process this GO :0055114 and oxidation-reduction process and biological process this GO :0060047 and heart contraction and biological process this GO :0060052 and neurofilament cytoskeleton organization and biological process this GO :0060087 and relaxation of vascular smooth muscle and biological process this GO :0060088 and auditory receptor cell stereocilium organization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071276 and cellular response to cadmium ion and biological process this GO :0071318 and cellular response to ATP and biological process this GO :0072593 and reactive oxygen species metabolic process and biological process this GO :0097332 and response to antipsychotic drug and biological process this GO :1902177 and positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway and biological process, this GO :0004784 : superoxide dismutase activity, this GO :0004784 : superoxide dismutase activity and also this GO :0005507 : copper ion binding and also this GO :0005515 : protein binding and also this GO :0008270 : zinc ion binding and also this GO :0019899 : enzyme binding and also this GO :0030346 : protein phosphatase 2B binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046872 : metal ion binding and also this GO :0048365 : Rac GTPase binding and also this GO :0051087 : chaperone binding, this GO :0005507 : copper ion binding, this GO :0005515 : protein binding, this GO :0008270 : zinc ion binding, this GO :0019899 : enzyme binding, this GO :0030346 : protein phosphatase 2B binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0046872 : metal ion binding, this GO :0048365 : Rac GTPase binding, this GO :0051087 : chaperone binding, superoxide dismutase 1
Identity: 11179
Gene: SOD1 | More about : SOD1
Long gene name: superoxide dismutase 1
Synonyms gene: ALS ALS1
Synonyms gene name: amyotrophic lateral sclerosis 1 (adult) superoxide dismutase 1, soluble
Synonyms: IPOA
Locus: 21q22, 11
Discovery year: 1986-01-01
GenBank acession: AY049787 X02317
Entrez gene record: 6647
Pubmed identfication: 8446170
RefSeq identity: NM_000454
Havana BLAST/BLAT: OTTHUMG00000084878
Locus Specific Databases: ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database LRG_652

Related Products :

MBS620593 Superoxide Dismutase, Mn (Manganese Superoxide Dismutase, Manganese SOD, Mn SOD, MnSOD, IPO-B, Superoxide Dismutase [Mn] Mitochondrial Precursor, Superoxide Dismutase 2 Mitochondrial, SOD 2, SOD2, SOD-2) Antibody 0.05 ml 669 € MBS Polyclonals_1 human
MBS621026 Superoxide Dismutase, Cu,Zn (Superoxide Dismutase Cu/Zn, SOD Cu,Zn, Cu/Zn SOD, CuZnSOD, SODC, Amyotrophic Lateral Sclerosis 1, ALS1, ALS, Ipo1, Ipo-1, Superoxide Dismutase 1 (Soluble), SOD1, SOD-1) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS619705 Superoxide Dismutase, Cu,Zn (Superoxide Dismutase Cu/Zn, SOD Cu,Zn, Cu/Zn SOD, Amyotrophic Lateral Sclerosis 1, ALS1, ALS, Homodimer, Indophenoloxidase A, IPOA, Superoxide Dismutase 1, Superoxide Dismutase 1 Soluble, SOD1, SOD-1, Superoxide Dismutase Cyst Antibody 100ul 652 € MBS Polyclonals_1 human
CE19 Recombinant Human Superoxide Dismutase [Cu-Zn], SOD1, Cu-Zn SOD (N-6His) 1 mg 2283 € novo human
RP-1442H Recombinant Human SOD1 / Superoxide Dismutase Protein (His Tag) 50μg 572 € adv human
SOD11-C Recombinant purified human Superoxide Dismutase 1 (SOD1) protein control for WB 100 μL 333 € adi human
DL-SOD1-Hu Human Superoxide Dismutase 1, Soluble SOD1 ELISA Kit 96T 869 € DL elisas human
SOD12-M Mouse Monoclonal Anti-human Superoxide Dismutase 1 (SOD1) protein 100 μg 565 € adi mouse
SOD11-A Sheep Anti-human Superoxide Dismutase 1 (SOD1) protein IgG 100 μL 565 € adi sheep
GWB-AE6A98 antibody to or anti- Superoxide Dismutase (SOD) Human (Mn Enzyme) antibody 1 vial 845 € genways human
MEDCLA574 Superoxide Dismutase (SOD), Cu/Zn, Clone: 30F11, Mouse Monoclonal antibody-Human; paraffin (NO frozen), IH/WB 1000ul 1132 € accurate-monoclonals human
OBT1616 Superoxide Dismutase (SOD), Mn, 25kD, Clone: MnS-1, Mouse Monoclonal antibody-Human, Rat; frozen, IH/WB 0.1mg 1074 € accurate-monoclonals rat
AR03033PU-L anti-Superoxide Dismutase 1 / SOD1 (1-154) Antibody 0,5 mg 1138 € acr human
AR03033PU-N anti-Superoxide Dismutase 1 / SOD1 (1-154) Antibody 0,1 mg 485 € acr human
AS09 539 anti-Superoxide Dismutase 1 / SOD1 (100-115) Antibody 50 Вµl 616 € acr human
AS09 540 anti-Superoxide Dismutase 1 / SOD1 (131-153) Antibody 50 Вµl 616 € acr human
AS09 535 anti-Superoxide Dismutase 1 / SOD1 (24-39) Antibody 50 Вµl 616 € acr human
AS09 534 anti-Superoxide Dismutase 1 / SOD1 (3-20) Antibody 0,1 ml 616 € acr human
AS09 536 anti-Superoxide Dismutase 1 / SOD1 (43-57) Antibody 50 Вµl 616 € acr human
AS09 537 anti-Superoxide Dismutase 1 / SOD1 (58-72) Antibody 50 Вµl 616 € acr human
AS13 2644 anti-Superoxide Dismutase 1 / SOD1 (58-72) Antibody 50 Вµg 587 € acr human
AS09 538 anti-Superoxide Dismutase 1 / SOD1 (80-96) Antibody 50 Вµl 616 € acr human
AM01230PU-N anti-Superoxide Dismutase 1 / SOD1 Antibody 0,1 mg 645 € acr human
AM06340SU-N anti-Superoxide Dismutase 1 / SOD1 Antibody 0,1 ml 630 € acr human
AM26611AF-N anti-Superoxide Dismutase 1 / SOD1 Antibody 0,1 mg 601 € acr human
AP00192PU-N anti-Superoxide Dismutase 1 / SOD1 Antibody 0,1 mg 587 € acr human
AP03021PU-S anti-Superoxide Dismutase 1 / SOD1 Antibody 25 Вµg 398 € acr human
AP03022PU-S anti-Superoxide Dismutase 1 / SOD1 Antibody 25 Вµg 398 € acr human
AP22845PU-N anti-Superoxide Dismutase 1 / SOD1 Antibody 50 Вµg 732 € acr human
BB-PA1345 anti-Superoxide Dismutase 1 / SOD1 Antibody 0,1 mg 471 € acr human