| Catalog number: | CE18 |
|---|---|
| Price: | 332 € |
| Supplier: | Bioss Primary Conjugated Antibodies. |
| Product name: | Recombinant Human Cysteine Dioxygenase Type 1, CDO1 (N-6His) |
| Quantity: | 100ul |
| Other quantities: | 1 mg 943€ 10 µg 100€ 50 µg 192€ |
| Related search: |
| Reacts with: | Human |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Human CDO1 is produced by our E, coli expression system and the target gene encoding Met1-Asn200 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: | 1 kD, 25 |
| UniProt number: | Q16878 |
| State of the product: | Liquid |
| Shipping conditions: | Dry ice/ice packs |
| Formulation: | 1 mM DTT, 10% Glycerol, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0 |
| Storage recommendations: | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MGSSHHHHHHSSGLVPRGSHMEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Properties: | Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: | recombinants |
| Gene target: | CDO1 (N-6His), Cysteine Dioxygenase 1 |
| Short name: | CDO1 (N-6His), Recombinant Cysteine Dioxygenase 1 |
| Technique: | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Humans, Human |
| Alternative name: | CDO1 (N-6His), sapiens Cysteine Dioxygenase classification 1, recombinant H |
| Alternative technique: | rec |
| Identity: | 1795 |
| Gene: | CDO1 | More about : CDO1 |
| Long gene name: | cysteine dioxygenase type 1 |
| Synonyms gene name: | cysteine dioxygenase, type I |
| Locus: | 5q22, 3 |
| Discovery year: | 1996-09-13 |
| Entrez gene record: | 1036 |
| Pubmed identfication: | 7524679 |
| RefSeq identity: | NM_001801 |
| Havana BLAST/BLAT: | OTTHUMG00000128891 |
| CE18 | Recombinant Human Cysteine Dioxygenase Type 1, CDO1 (N-6His) | 10 µg | 100 € | novo | human |
| MBS621840 | Indoleamine 2,3-Dioxygenase-like 1 protein (INDOL1, IDO2, indoleamine 2,3-dioxygenase 2, indoleamine-pyrrole 2,3 dioxygenase-like 1) | 100ug | 591 € | MBS Polyclonals_1 | human |
| LV115087 | CDO1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV115088 | CDO1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV115089 | CDO1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV115090 | CDO1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV115092 | CDO1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| LV115091 | CDO1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) | 1.0 µg DNA | 322 € | ABM lentivectors | human |
| AP50181HU-100ug | Human CDO1 Protein | 0.1mg | 184 € | abebio | human |
| AP50181HU-1mg | Human CDO1 Protein | 1mg | 604 € | abebio | human |
| CE50 | Recombinant Human 4-Hydroxyphenylpyruvate Dioxygenase, 4HPPD, HPPDase (N-6His) | 10 µg | 202 € | novo | human |
| CP06 | Recombinant Human Indoleamine 2,3-Dioxygenase, IDO, INDO (N-6His) | 10 µg | 202 € | novo | human |
| AR09276PU-L | anti-CDO1 (1-170, His-tag) Antibody | 0,5 mg | 833 € | acr | human |
| AR09276PU-N | anti-CDO1 (1-170, His-tag) Antibody | 0,1 mg | 384 € | acr | human |
| GENTAUR-58bdeab718118 | Anti- CDO1 Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |
| GENTAUR-58bdeab77cc87 | Anti- CDO1 Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |
| GENTAUR-58bdee3f1850c | Anti- CDO1 Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |
| GENTAUR-58bdee3f6c266 | Anti- CDO1 Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |
| GENTAUR-58bdfeddc7b60 | Anti- CDO1 Antibody | 0.06 ml | 265 € | MBS Polyclonals | human |
| GENTAUR-58bdfede235bb | Anti- CDO1 Antibody | 0.12 ml | 348 € | MBS Polyclonals | human |
| abx149173 | Anti-CDO1 Antibody | 100 μg | 311 € | abbex | human |
| GENTAUR-58be63e9509db | Anti-CDO1 (Polyclonal), ALEXA Fluor 594 | 100 microliters | 489 € | Bioss Polyclonal Antibodies | human |
| abx900982 | Anti-CDO1 siRNA | inquire | 50 € | abbex | human |
| abx911336 | Anti-CDO1 siRNA | 30 nmol | 717 € | abbex | human |
| abx911337 | Anti-CDO1 siRNA | 15 nmol | 528 € | abbex | human |
| bs-5808R-A350 | CDO1 Antibody, ALEXA FLUOR 350 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-5808R-A488 | CDO1 Antibody, ALEXA FLUOR 488 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-5808R-A555 | CDO1 Antibody, ALEXA FLUOR 555 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-5808R-A594 | CDO1 Antibody, ALEXA FLUOR 594 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bs-5808R-A647 | CDO1 Antibody, ALEXA FLUOR 647 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |