Recombinant Human Amyloid β A4 Precursor Protein-Binding A3, APBA3, X11-γ (C-6His)

Contact us
Catalog number: CE16
Price: 647 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Amyloid β A4 Precursor Protein-Binding A3, APBA3, X11-γ (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: also called a , is a type of partially differentiated, usually , Precursor cell, blast, blast cell , cell that has lost most or all of the , multipotency, or simply , stem cell , unipotent 
Molecular Weight: 15, 48 kD
UniProt number: O96018
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB , Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDFPTISRSPSGPPAMDLEGPRDILVPSEDLTPDSQWDPMPGGPGSLSRMELDESSLQELVQQFEALPGDLVGPSPGGAPCPLHIATGHGLASQEIADAHGLLSAEAGRDDLLGLLHCEECPPSQTGPEEPLEPAPRLLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: (C-6His), A4 Precursor Protein-Binding A3, APBA3, X11-&gamma, Amyloid &beta
Short name: (C-6His), A4 Protein-Binding A3, APBA3, X11-&gamma, Recombinant Amyloid &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: (C-6His), A4 Precursor Protein-Binding A3, APBA3, X11-&gamma, sapiens Amyloid &beta, recombinant H
Alternative technique: rec
Identity: 580
Gene: APBA3 | More about : APBA3
Long gene name: amyloid beta precursor protein binding family A member 3
Synonyms gene name: amyloid beta (A4) precursor protein-binding, family A, member 3
Synonyms: X11L2 mint3
Synonyms name: X11-like 2
Locus: 19p13, 3
Discovery year: 1999-04-22
GenBank acession: AB021638
Entrez gene record: 9546
Pubmed identfication: 10049767
Classification: PDZ domain containing
Havana BLAST/BLAT: OTTHUMG00000180915

Related Products :

MBS622305 Amyloid beta A3 Precursor Protein (APBA3, X11-gamma, Adaptor protein X11 gamma, Mint3, X11L2) Antibody 100ug 774 € MBS Polyclonals_1 human
CE16 Recombinant Human Amyloid β A4 Precursor Protein-Binding A3, APBA3, X11-γ (C-6His) 1 mg 2283 € novo human
GENTAUR-58b8c68d0d7f2 Human Amyloid beta A4 precursor protein-binding family A member 3 (APBA3) 100ug 2575 € MBS Recombinant Proteins human
GENTAUR-58b8c68d6a2f4 Human Amyloid beta A4 precursor protein-binding family A member 3 (APBA3) 1000ug 2575 € MBS Recombinant Proteins human
GENTAUR-58b8c68dd58de Human Amyloid beta A4 precursor protein-binding family A member 3 (APBA3) 100ug 3089 € MBS Recombinant Proteins human
GENTAUR-58b8c68e3abf4 Human Amyloid beta A4 precursor protein-binding family A member 3 (APBA3) 1000ug 3089 € MBS Recombinant Proteins human
GENTAUR-58b9c77d5865c Human Amyloid beta A4 precursor protein-binding family A member 3 (APBA3) 100ug 2575 € MBS Recombinant Proteins human
GENTAUR-58b9c77daf9da Human Amyloid beta A4 precursor protein-binding family A member 3 (APBA3) 1000ug 2575 € MBS Recombinant Proteins human
GENTAUR-58b9c77e29921 Human Amyloid beta A4 precursor protein-binding family A member 3 (APBA3) 100ug 3089 € MBS Recombinant Proteins human
GENTAUR-58b9c77e936d5 Human Amyloid beta A4 precursor protein-binding family A member 3 (APBA3) 1000ug 3089 € MBS Recombinant Proteins human
GENTAUR-58bdc6af9b9e5 Anti- Amyloid Beta Precursor Protein Binding Protein A3 (APBA3) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc6b028719 Anti- Amyloid Beta Precursor Protein Binding Protein A3 (APBA3) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd3735cf01 Anti- Amyloid Beta Precursor Protein Binding Protein A3 (APBA3) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd60848c22 Anti- Amyloid Beta Precursor Protein Binding Protein A3 (APBA3) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bd280e3335b Mouse Amyloid beta A4 precursor protein-binding family A member 3 (Apba3) 100ug 2569 € MBS Recombinant Proteins mouse
GENTAUR-58bd280e74f42 Mouse Amyloid beta A4 precursor protein-binding family A member 3 (Apba3) 1000ug 2569 € MBS Recombinant Proteins mouse
GENTAUR-58bd280ec3307 Mouse Amyloid beta A4 precursor protein-binding family A member 3 (Apba3) 100ug 3078 € MBS Recombinant Proteins mouse
GENTAUR-58bd280f162fb Mouse Amyloid beta A4 precursor protein-binding family A member 3 (Apba3) 1000ug 3078 € MBS Recombinant Proteins mouse
GENTAUR-58b9c47999509 Rat Amyloid beta A4 precursor protein-binding family A member 3 (Apba3) 100ug 2558 € MBS Recombinant Proteins rat
GENTAUR-58b9c47a14f33 Rat Amyloid beta A4 precursor protein-binding family A member 3 (Apba3) 1000ug 2558 € MBS Recombinant Proteins rat
GENTAUR-58b9c47a71c79 Rat Amyloid beta A4 precursor protein-binding family A member 3 (Apba3) 100ug 3072 € MBS Recombinant Proteins rat
GENTAUR-58b9c47ac7b58 Rat Amyloid beta A4 precursor protein-binding family A member 3 (Apba3) 1000ug 3072 € MBS Recombinant Proteins rat
MBS620568 Amyloid Precursor Protein, 653-662 (APP, Amyloid beta (A4) Precursor Protein) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS622993 Amyloid Precursor Protein, 737-751 (APP, Amyloid beta (A4) Precursor Protein) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS616344 Amyloid Precursor Protein. Frameshift Mutant (APP, Amyloid beta (A4) Precursor Protein) 200ul 520 € MBS Polyclonals_1 human
MBS612160 Amyloid Precursor Protein Frameshift Mutant (APP, Amyloid beta (A4) Precursor Protein) Antibody 100ul 641 € MBS Polyclonals_1 human
MBS615129 Amyloid Precursor Protein, Kpi Domain (APP, Amyloid beta (A4) Precursor Protein) Antibody 100ul 674 € MBS Polyclonals_1 human
MBS618537 Amyloid Precursor Protein, Kpi Domain (APP, Amyloid beta (A4) Precursor Protein) Antibody 100ul 680 € MBS Polyclonals_1 human
MBS612541 Amyloid Precursor Protein, ox-2 Domain (APP, Amyloid beta (A4) Precursor Protein) Antibody 100ul 680 € MBS Polyclonals_1 human
MBS620533 Synuclein, alpha, beta, gamma (SNCA, Alpha Synuclein, MGC110988, Non-A beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, NACP, PARK1, PARK4, Parkinson Disease Familial 1, PD1) Antibody 1000ug 647 € MBS Polyclonals_1 human