Recombinant Human Chloride Intracellular Channel Protein 4, CLIC4 (N-6His)

Contact us
Catalog number: CE14
Price: 1569 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Chloride Intracellular Channel Protein 4, CLIC4 (N-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CLIC4 is produced by our E, coli expression system and the target gene encoding Met1-Lys253 is expressed with a 6His tag at the N-terminus
Molecular Weight: 30, 9 kD
UniProt number: Q9Y696
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 1 mM DTT, 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CLIC4 (N-6His), Chloride Intracellular Channel Protein 4
Short name: CLIC4 (N-6His), Recombinant Chloride Intracellular Channel Protein 4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CLIC4 (N-6His), sapiens Chloride Intracellular Channel Protein 4, recombinant H
Alternative technique: rec
Identity: 13518
Gene: CLIC4 | More about : CLIC4
Long gene name: chloride intracellular channel 4
Synonyms: DKFZP566G223 CLIC4L P64H1 H1 huH1 p64H1
Locus: 1p36, 11
Discovery year: 2000-10-31
GenBank acession: AF097330
Entrez gene record: 25932
Pubmed identfication: 9139710 10070163
RefSeq identity: NM_013943
Classification: Chloride intracellular channels
Havana BLAST/BLAT: OTTHUMG00000003327

Related Products :

CE14 Recombinant Human Chloride Intracellular Channel Protein 4, CLIC4 (N-6His) 50 µg 496 € novo human
DL-CLIC4-Hu Human Chloride Intracellular Channel Protein 4 CLIC4 ELISA Kit 96T 904 € DL elisas human
GWB-C8BC29 Chloride Intracellular Channel 4 (CLIC4) Goat antibody to or anti-Human Polyclonal (N- terminus) antibody 1 vial 602 € genways human
GENTAUR-58bdc1d0ab758 Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc1d1081c8 Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc22d34ca2 Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc28a75ef4 Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc28b0d409 Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc2a479bc3 Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdc2a4d36ab Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdcdf49e78c Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdceeab1330 Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd48da86fd Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bdd62ca067c Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bddb333039e Anti- Chloride Intracellular Channel Protein 4 (CLIC4) Antibody 100ug 575 € MBS Polyclonals human
EKU03130 Chloride Intracellular Channel Protein 4 (CLIC4) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
CG13 Recombinant Human Chloride Intracellular Channel Protein 1, CLIC1 (N-6His) 500 µg 1613 € novo human
C266 Recombinant Human Chloride Intracellular Channel Protein 2, CLIC2 (N-6His) 10 µg 202 € novo human
CG59 Recombinant Human Chloride Intracellular Channel Protein 3, CLIC3 (C-6His) 50 µg 496 € novo human
C212 Recombinant Human Chloride Intracellular Channel Protein 5, CLIC5 (N-6His) 50 µg 496 € novo human
abx260603 Anti-Chloride Intracellular Channel 1 Protein (Recombinant) 25 µg 340 € abbex human
abx261324 Anti-Chloride Intracellular Channel 2 Protein (Recombinant) 5 µg 238 € abbex human
abx261948 Anti-Chloride Intracellular Channel 4 Protein (Recombinant) 1 mg 4675 € abbex human
abx167951 Anti-Chloride Intracellular Channel Protein 1 (Recombinant) 100 μg 891 € abbex human
GENTAUR-58ba98297029e Human Chloride intracellular channel protein 1 (CLIC1) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58ba9829ec090 Human Chloride intracellular channel protein 1 (CLIC1) 1000ug 2078 € MBS Recombinant Proteins human
DL-CLIC1-Hu Human Chloride Intracellular Channel Protein 1 CLIC1 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58ba72077b971 Human Chloride intracellular channel protein 2 (CLIC2) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58ba7207e0f9e Human Chloride intracellular channel protein 2 (CLIC2) 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58baf94ec8f30 Human Chloride intracellular channel protein 3 (CLIC3) 1000ug 1569 € MBS Recombinant Proteins human