Recombinant Human Estrogen Receptor α, ERα, NR3A1 (N-6His)

Contact us
Catalog number: CE11
Price: 2283 €
Supplier: novo
Product name: Recombinant Human Estrogen Receptor α, ERα, NR3A1 (N-6His)
Quantity: 1 mg
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Estrogen receptor alpha is produced by our E, coli expression system and the target gene encoding Met1-Gln116 is expressed with a 6His tag at the N-terminus
Molecular Weight: 14, 38 kD
UniProt number: P03372
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ER&alpha, NR3A1 (N-6His), Estrogen Receptor &alpha
Short name: ER&alpha, NR3A1 (N-6His), Recombinant Estrogen Receptor &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: ER&alpha, NR3A1 (N-6His), sapiens Estrogen Receptor &alpha, recombinant H
Alternative technique: rec
Identity: 3467
Gene: ESR1 | More about : ESR1
Long gene name: estrogen receptor 1
Synonyms gene: ESR
Synonyms: NR3A1 Era
Locus: 6q25, 1-q25, 2
Discovery year: 2001-06-22
GenBank acession: X03635
Entrez gene record: 2099
Pubmed identfication: 3754034
Classification: Nuclear hormone receptors
Havana BLAST/BLAT: OTTHUMG00000016103
Locus Specific Databases: LRG_992

Related Products :

CE11 Recombinant Human Estrogen Receptor α, ERα, NR3A1 (N-6His) 500 µg 1613 € novo human
MBS624548 Estrogen Receptor, phosphorylated (S118) (ER, ER-alpha, Estradiol Receptor, Nuclear Receptor Subfamily 3 Group A Member 1, ESR1, ESR, NR3A1) Antibody 100ug 680 € MBS Polyclonals_1 human
MBS624144 Estrogen Receptor alpha, phosphorylated (Ser104) (ER, ER alpha, Era, ESR, ESR, ESR1, ESRA, Estradiol Receptor, Estrogen Receptor, Estrogen Receptor 1) Antibody 50ug 481 € MBS Polyclonals_1 human
GWB-402266 Estrogen Receptor Alpha (ER Alpha/NR3A1) (ESR1) Mouse antibody to or anti-Human Monoclonal (aa410-592) antibody 1 x 1 vial 602 € genways human
GWB-2EDB09 Estrogen Receptor Alpha (ER Alpha/NR3A1) (ESR1) Rabbit antibody to or anti-Human Polyclonal (C- terminus) (S21-V) antibody 1 x 1 vial 648 € genways human
GWB-8E047A Estrogen Receptor Alpha (ER Alpha/NR3A1) (ESR1) Rabbit antibody to or anti-Human Polyclonal (pSer104/106) antibody 1 vial 602 € genways human
GWB-87C881 Estrogen Receptor Alpha (ER Alpha/NR3A1) (ESR1) Rabbit antibody to or anti-Human Polyclonal (Ser167) antibody 1 vial 602 € genways human
GENTAUR-58be2d7a7aa67 Mouse Anti-Estrogen Receptor alpha/ERalpha/ERS1 500ul 409 € MBS mono mouse
GENTAUR-58be2d7adb2ac Mouse Anti-Estrogen Receptor alpha/ERalpha/ERS1 Antibody 500ul 409 € MBS mono mouse
MBS619674 Estrogen-Related Receptor, gamma (ERR gamma, ERRg, ESRRG, DKFZP781L1617, Estrogen Receptor Related Protein 3, ERR3, FLJ16023, KIAA0832, Nuclear Receptor Subfamily 3 Group B Member 3, NR3B3) Antibody 50ug 928 € MBS Polyclonals_1 human
CF53 Recombinant Human Estrogen Receptor β, ERβ, NR3A2 (N-6His) 50 µg 369 € novo human
MBS619896 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX Receptor beta, LXRa, LXR-a, LXRalpha, LXRb, LXR-b, LXRbeta, NERI, NER-I, NR1H2, NR1H3, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 100ug 763 € MBS Polyclonals_1 human
MBS611189 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX receptor beta, LXRa, LXRalpha, LXRb, LXRbeta, NERI, NR1H2, NR1H3, Nuclear Orphan Receptor LXR alpha, Nuclear Orphan Receptor LXR beta, Nuclear Receptor Antibody 100ug 735 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
RP-940 Recombinant (E.Coli) Human Estrogen Receptor Alpha 2 μg 405 € adi human
MBS620850 Adrenergic Receptor alpha 2a (Alpha-2A Adrenergic Receptor, Alpha-2AAR, alpha2AAR, A2aAR, ADRA2A, ADRA2, ADRA2R, ADRAR, Alpha-2 Adrenergic Receptor Subtype C10, Alpha-2A Adrenoceptor, Alpha-2A Adrenoreceptor, ZNF32) Antibody 100ug 652 € MBS Polyclonals_1 human
MBS622722 GFR alpha1 (Glial Cell Line Derived Neurotrophic Factor Receptor Alpha 1, GDNF Family Receptor alpha 1, GDNF Receptor alpha 1, GFR-alpha-1, GFRalpha1, GFRA1, GDNF Receptor alpha, GDNFR alpha, GDNFR-alpha, GDNFRa, GDNFR, GPI-linked Anchor Protein, MGC23045 Antibody 100ug 857 € MBS Polyclonals_1 human
abx167107 Anti-Estrogen Receptor alpha Protein (Recombinant) 50 μg 615 € abbex human
abx167364 Anti-Estrogen Receptor alpha Protein (Recombinant) 50 μg 615 € abbex human
abx263538 Anti-Estrogen Receptor alpha Protein (Recombinant) 2 µg 427 € abbex human
MBS622505 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Ox-1-R, Ox1-R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) Antibody 100ug 652 € MBS Polyclonals_1 human
MBS614684 Estrogen-Related Receptor, alpha (ERRa, NR3B1, NR3 Steroid Receptor) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS624399 Estrogen-Related Receptor, alpha (ERRa, NR3B1, NR3 Steroid Receptor) Antibody 100ug 614 € MBS Polyclonals_1 human
C632 Recombinant Human Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 1 mg 2283 € novo human
MBS620439 Folate receptor 1 (FOLR1) (folate receptor 1 (adult) Adult folate-binding protein, FBP, Folate receptor, adult, Folate receptor 1, Folate receptor alpha, FR-alpha, KB cells FBP, MOv18, Ovarian tumor-associated antigen MOv18) Antibody 100ug 774 € MBS Polyclonals_1 human
C784 Recombinant Human Folate Receptor α, FOLR1 (C-6His) 10 µg 146 € novo human
C471 Recombinant Human GDNF Family Receptor α-1, GFRA1 (C-6His) 10 µg 90 € novo human
C472 Recombinant Human GDNF Receptor α-2, GFRA2 (C-6His) 10 µg 90 € novo human
CJ30 Recombinant Human GDNF Receptor α-2, GFRA2 (C-Fc-6His) 10 µg 100 € novo human
CJ77 Recombinant Human IL-2 Receptor Subunit α, IL-2RA, CD25 (C-6His) 1 mg 2283 € novo human