Recombinant Human Phosphatidylinositol Transfer Protein α Isoform, PITPNA (N-6His)

Contact us
Catalog number: CE10
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Phosphatidylinositol Transfer Protein α Isoform, PITPNA (N-6His)
Quantity: inquire
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human PITPNA is produced by our E, coli expression system and the target gene encoding Met1-Asp270 is expressed with a 6His tag at the N-terminus
Molecular Weight: 34 kD
UniProt number: Q00169
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 1 mM DTT, 1 mM EDTA, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Isoform, PITPNA (N-6His), Phosphatidylinositol Transfer Protein &alpha
Short name: Isoform, PITPNA (N-6His), Recombinant Phosphatidylinositol Transfer Protein &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: Isoform, PITPNA (N-6His), sapiens Phosphatidylinositol Transfer Protein &alpha, recombinant H
Alternative technique: rec
Identity: 9001
Gene: PITPNA | More about : PITPNA
Long gene name: phosphatidylinositol transfer protein alpha
Synonyms gene: PITPN
Synonyms gene name: phosphotidylinositol transfer protein
Synonyms: VIB1A
Locus: 17p13, 3
Discovery year: 1994-03-24
GenBank acession: M73704
Entrez gene record: 5306
Pubmed identfication: 8255295
Classification: Phosphatidylinositol transfer proteins
Havana BLAST/BLAT: OTTHUMG00000177779

Related Products :

CE10 Recombinant Human Phosphatidylinositol Transfer Protein α Isoform, PITPNA (N-6His) 500 µg 1613 € novo human
MBS621239 Phosphatidylinositol Transfer Protein alpha, CT (PITP, PtdIns Transfer Protein alpha, PtdInsTP alpha, PI-TP-alpha, PITPNA, PITPN) Antibody 100ug 763 € MBS Polyclonals_1 human
AE58063HU-48 ELISA test for Human Phosphatidylinositol transfer protein alpha isoform (PITPNA) 1x plate of 48 wells 373 € abebio human
AE58063HU-96 Human Phosphatidylinositol transfer protein alpha isoform (PITPNA) ELISA Kit 1x plate of 96 wells 612 € abebio human
MBS619502 Phosphatidylinositol transfer protein (PITPN, PITPNB, phosphotidylinositol transfer protein, phosphatidylinositol transfer protein, PITP alpha) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS621798 Phosphatidylinositol Transfer Protein (PITPN, PITPNB, Phosphotidylinositol Transfer Protein, PITP alpha) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS623428 PI3KCG, ID (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit gamma Isoform, PtdIns-3-kinase Subunit gamma, PI3K-gamma, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit gamma, PtdIns-3-kinase Subunit p110-gamma, p120-P Antibody 200ul 603 € MBS Polyclonals_1 human
AE63083HU-48 ELISA test for Human Phosphatidylinositol transfer protein beta isoform (PITPNB) 1x plate of 48 wells 373 € abebio human
AE63083HU-96 Human Phosphatidylinositol transfer protein beta isoform (PITPNB) ELISA Kit 1x plate of 96 wells 612 € abebio human
MBS622431 PPP2R5A (Serine/Threonine-Protein Phosphatase 2A 56kD Regulatory Subunit A alpha Isoform, PP2A B Subunit Isoform B'-alpha, PP2A B Subunit Isoform B56-alpha, PP2A B Subunit Isoform PR61-alpha, PP2A B Subunit Isoform R5-alpha, PR61alpha, PP2A B Subunit Isof Antibody 100ug 763 € MBS Polyclonals_1 human
MBS624524 PI4K2A, NT (Phosphatidylinositol 4-kinase Type 2 alpha, PIK42A, Phosphatidylinositol 4-kinase Type II-alpha, PI4KII, DKFZp761G1923, RP11-548K23.6) Antibody 200ul 597 € MBS Polyclonals_1 human
MBS621558 SEC61A (SEC61 alpha, HSEC61, Protein Transport Protein SEC61 alpha Subunit Isoform 1, Protein Transport Protein Sec61 Subunit alpha Isoform 1, Sec61 alpha 1, Sec61 alpha 1 Subunit, Sec61 alpha1, SEC61A1, SEC61, Sec61 Homolog) Antibody 100ug 735 € MBS Polyclonals_1 human
abx260827 Anti-Phosphatidylinositol Transfer Protein, alpha Protein (Recombinant) 25 µg 340 € abbex human
GWB-P1212C PITPNA, 1-270aa, Recombinant Protein bulk Ask price € genways bulk human
MBS620267 PPP2R5D (Serine/Threonine-Protein Phosphatase 2A 65kD Regulatory Subunit A delta Isoform, PP2A B Subunit Isoform B'-delta, PP2A B Subunit Isoform B56-delta, PP2A B Subunit Isoform PR61-delta, PP2A B Subunit Isoform R5-delta) Antibody 100ug 752 € MBS Polyclonals_1 human
abx260804 Anti-Phosphatidylinositol Transfer Protein, beta Protein (Recombinant) 25 µg 340 € abbex human
GWB-BSP579 PITPNA Human Protein bulk Ask price € genways bulk human
LV263269 PITPNA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
C921 Recombinant Human Phosphatidylinositol 4-Kinase β, PI4KB (C-6His) 10 µg 202 € novo human
CJ35 Recombinant Human Phosphatidylinositol 5-Phosphate 4-Kinase 2α, PIP4K2A (C-6His) 1 mg 2486 € novo human
MBS620204 Phosphoinositide 3 Kinase, p110 beta (DKFZp779K1237, MGC133043, p110beta, Phosphatidylinositol 3 Kinase Catalytic beta Polypeptide, Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit beta Isoform, Phosphoinositide 3 Kinase Catalytic beta Pol Antibody 100ul 542 € MBS Polyclonals_1 human
MBS624028 PIP5K1B, NT (Phosphatidylinositol-4-phosphate 5-kinase Type-1 beta, PIP5K1-beta, PtdIns(4)P-5-kinase 1 beta, Phosphatidylinositol-4-phosphate 5-kinase Type I beta, PIP5KIbeta, Protein STM-7, Type I Phosphatidylinositol-4-phosphate 5-kinase beta, STM7) 200ul 603 € MBS Polyclonals_1 human
abx250885 Anti-Human Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform ELISA Kit inquire 50 € abbex human
AE27437HU-48 ELISA test for Human Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PIK3CA) 1x plate of 48 wells 373 € abebio human
AE27437HU-96 Human Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PIK3CA) ELISA Kit 1x plate of 96 wells 612 € abebio human
AR09766PU-L anti-PITPNA (1-270, His-tag) Antibody 0,5 mg 1138 € acr human
AR09766PU-N anti-PITPNA (1-270, His-tag) Antibody 0,1 mg 485 € acr human
abx217783 Anti-PITPNA Antibody inquire 50 € abbex human
abx904036 Anti-PITPNA siRNA 30 nmol 717 € abbex human
abx928683 Anti-PITPNA siRNA inquire 50 € abbex human