Recombinant Human Rho GTPase-Activating Protein 25, ARHGAP25 (C-6His)

Contact us
Catalog number: CD99
Price: 3580 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Rho GTPase-Activating Protein 25, ARHGAP25 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human ARHGAP25 is produced by our Mammalian expression system and the target gene encoding Met1-Leu458 is expressed with a 6His tag at the C-terminus
Molecular Weight: 52, 8 kD
UniProt number: P42331-2
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 5 mM MgCl2, pH 7, 1 mM DTT, 2 um filtered solution of 20 mMTrisHCl, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMVRCREPSCFHWVLPLVQAIPCKACSRVAIWGVLGDAVAVGAAATDSSEHTLKAWPLSKSSFYWHLVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ARHGAP25 (C-6His), Rho GTPase-Activating Protein 25
Short name: ARHGAP25 (C-6His), Recombinant Rho GTPase-Activating Protein 25
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ARHGAP25 (C-6His), sapiens Rho GTPase-Activating Protein 25, recombinant H
Alternative technique: rec
Identity: 28951
Gene: ARHGAP25 | More about : ARHGAP25
Long gene name: Rho GTPase activating protein 25
Synonyms: KIAA0053
Locus: 2p13, 3
Discovery year: 2004-04-06
GenBank acession: D29642
Entrez gene record: 9938
Pubmed identfication: 7584044
RefSeq identity: NM_014882
Classification: Pleckstrin homology domain containing Rho GTPase activating proteins
Havana BLAST/BLAT: OTTHUMG00000152621

Related Products :

CD99 Recombinant Human Rho GTPase-Activating Protein 25, ARHGAP25 (C-6His) 1 mg 2486 € novo human
MBS623933 ARHGAP18, ID (Rho GTPase-activating Protein 18, Rho-type GTPase-activating Protein 18, MacGAP) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS611554 ROK alpha (Rho-associated Kinase-alpha, ROK-alpha, Rho-associated Coiled-coil Containing Protein Kinase 2, Rho-associated Protein Kinase 2, Rho Kinase 2, ROCK2, Rock2m, ROCK-2, p164 ROCK-2, ROCK-II, Rho-kinase) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS613174 NFkB Activating Kinase (Nuclear Factor kappa B Activating Kinase, NF-kappa-B-activating Kinase, NF-kB-activating Kinase, NAK, EC 2.7.11.1, FLJ11330, Serine/threonine Protein Kinase TBK1, Serine/threonine Protein Kinase TBK-1, T2K, TANK-binding Kinase 1, T Antibody 100ul 785 € MBS Polyclonals_1 human
MBS617529 ROK alpha (Rho-associated, coiled-coil containing protein kinase 2, p150 serine/threonine kinase, ROCK-2, ROCK-II, Rho-associated kinase-alpha, Rho-kinase) Antibody 200ug 691 € MBS Polyclonals_1 human
MBS619461 BORG2 (Binder of Rho GTPases 2, CDC42 Effector Protein (Rho GTPase Binding) 3, Cdc42 Effector Protein 3, CDC42EP3, CEP3, ORG2, UB1) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS620626 BORG2 (Binder of Rho GTPases 2, CDC42 Effector Protein (Rho GTPase Binding) 3, Cdc42 Effector Protein 3, CDC42EP3, CEP3, ORG2, UB1) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS621919 ARFGAP3 (ADP-ribosylation factor GTPase activating protein 3, ARFGAP1, RP1-47A17.3, ADP-ribosylation factor GTPase activating protein 1, OTTHUMP00000028526) Antibody 100ug 707 € MBS Polyclonals_1 human
MBS610595 RanGAP 1 (Ran GTPase Activating Protein 1, Ran GTPase-activating Protein 1, RanGAP1, Fug1, KIAA1835, MGC20266, OTTHUMP00000028918, Ran1, Ran-1, Segregation Distortion, Segregation Distorter Homolog, SD) Antibody 100ul 923 € MBS Polyclonals_1 human
abx251132 Anti-Human Rho GTPase-activating protein 21 ELISA Kit inquire 50 € abbex human
GENTAUR-58bd935b104bf Human Rho GTPase-activating protein 11B (ARHGAP11B) 100ug 1785 € MBS Recombinant Proteins human
GENTAUR-58bd935b8c8b8 Human Rho GTPase-activating protein 11B (ARHGAP11B) 1000ug 1785 € MBS Recombinant Proteins human
GENTAUR-58bd935bed731 Human Rho GTPase-activating protein 11B (ARHGAP11B) 100ug 2299 € MBS Recombinant Proteins human
GENTAUR-58bd935c6a85f Human Rho GTPase-activating protein 11B (ARHGAP11B) 1000ug 2299 € MBS Recombinant Proteins human
GENTAUR-58bd6bc27d1f4 Human Rho GTPase-activating protein 36 (ARHGAP36) 100ug 2404 € MBS Recombinant Proteins human
GENTAUR-58bd6bc2dbffe Human Rho GTPase-activating protein 36 (ARHGAP36) 1000ug 2404 € MBS Recombinant Proteins human
GENTAUR-58bd6bc33029f Human Rho GTPase-activating protein 36 (ARHGAP36) 100ug 2917 € MBS Recombinant Proteins human
GENTAUR-58bd6bc3754a3 Human Rho GTPase-activating protein 36 (ARHGAP36) 1000ug 2917 € MBS Recombinant Proteins human
GENTAUR-58be643b97497 Anti-Rho GTPase activating protein 29, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
GENTAUR-58bc7cc5a1ebc Bovine Rho GTPase-activating protein 15 (ARHGAP15) 100ug 2310 € MBS Recombinant Proteins bovine
GENTAUR-58bc7cc5f2e3a Bovine Rho GTPase-activating protein 15 (ARHGAP15) 1000ug 2310 € MBS Recombinant Proteins bovine
GENTAUR-58bc7cc652634 Bovine Rho GTPase-activating protein 15 (ARHGAP15) 100ug 2824 € MBS Recombinant Proteins bovine
GENTAUR-58bc7cc699e4b Bovine Rho GTPase-activating protein 15 (ARHGAP15) 1000ug 2824 € MBS Recombinant Proteins bovine
GENTAUR-58bd70d090784 Chicken Rho GTPase-activating protein 19 (ARHGAP19) 100ug 2371 € MBS Recombinant Proteins chicken
GENTAUR-58bd70d0d92a6 Chicken Rho GTPase-activating protein 19 (ARHGAP19) 1000ug 2371 € MBS Recombinant Proteins chicken
GENTAUR-58bd70d12d2ce Chicken Rho GTPase-activating protein 19 (ARHGAP19) 100ug 2884 € MBS Recombinant Proteins chicken
GENTAUR-58bd70d181b4a Chicken Rho GTPase-activating protein 19 (ARHGAP19) 1000ug 2884 € MBS Recombinant Proteins chicken
GENTAUR-58bd71ad15af9 Mouse Rho GTPase-activating protein 10 (Arhgap10) 100ug 3072 € MBS Recombinant Proteins mouse
GENTAUR-58bd71ad6485c Mouse Rho GTPase-activating protein 10 (Arhgap10) 1000ug 3072 € MBS Recombinant Proteins mouse
GENTAUR-58bd71ad9f98e Mouse Rho GTPase-activating protein 10 (Arhgap10) 100ug 3580 € MBS Recombinant Proteins mouse