| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human VSIG4 is produced by our Mammalian expression system and the target gene encoding Arg20-Val284 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
3 kD, 56 |
| UniProt number: |
Q9Y279 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CRIg (C-Fc), VSIG4, V-Set Ig Domain Protein 4 |
| Short name: |
CRIg (C-Fc), VSIG4, Recombinant V-Set Ig Domain- Protein 4 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CRIg (C-fragment c), V-set and immunoglobulin domain containing 4, sapiens V-Set and Ig Domain-Containing Protein 4, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CRIg and Z39IG, Plasma membranes, VSIG4 and IDBG-637672 and ENSBTAG00000015769 and 614262, VSIG4 and IDBG-73541 and ENSG00000155659 and 11326, Vsig4 and IDBG-160903 and ENSMUSG00000044206 and 278180, alternative pathway and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0032703 and negative regulation of interleukin-2 production and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, protein binding, this GO :0005515 and protein binding and molecular function this GO :0006957 and complement activation, this GO :0005515 : protein binding, this GO :0005515 : protein binding, V-set and immunoglobulin domain containing 4 |
| Identity: |
17032 |
| Gene: |
VSIG4 |
More about : VSIG4 |
| Long gene name: |
V-set and immunoglobulin domain containing 4 |
| Synonyms: |
Z39IG |
| Locus: |
Xq12 |
| Discovery year: |
2004-09-10 |
| GenBank acession: |
AJ132502 |
| Entrez gene record: |
11326 |
| Pubmed identfication: |
11004523 17016555 17016562 |
| RefSeq identity: |
NM_007268 |
| Classification: |
V-set domain containing Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000021727 |
| Locus Specific Databases: |
Mental Retardation database |