Recombinant Human NKG2D Ligand 2, NKG2DL2, N2DL2 (C-Fc)

Contact us
Catalog number: CD42
Price: 426 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human NKG2D Ligand 2, NKG2DL2, N2DL2 (C-Fc)
Quantity: 50ug
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling
Molecular Weight: 4 kD, 51
UniProt number: Q9BZM5
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: N2DL2 (C-Fc), NKG2DL2, NKG2D Ligand 2
Short name: N2DL2 (C-Fc), NKG2DL2, Recombinant NKG2D Ligand 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: N2DL2 (C-fragment c), NKG2DL2, sapiens NKG2D Ligand 2, recombinant H
Alternative technique: rec
Identity: 18788
Gene: KLRK1 | More about : KLRK1
Long gene name: killer cell lectin like receptor K1
Synonyms gene: D12S2489E
Synonyms gene name: DNA segment on chromosome 12 (unique) 2489 expressed sequence killer cell lectin-like receptor subfamily K, member 1
Synonyms: NKG2D KLR NKG2-D CD314
Locus: 12p13, 2
Discovery year: 2003-12-12
GenBank acession: AJ001687
Entrez gene record: 22914
Pubmed identfication: 9683661 2007850
RefSeq identity: NM_007360
Classification: Killer cell lectin like receptors CD molecules C-type lectin domain containing
Havana BLAST/BLAT: OTTHUMG00000168574

Related Products :

C508 Recombinant Human NKG2D Ligand 2, NKG2DL2, N2DL2 (C-6His) 10 µg 121 € novo human
CD42 Recombinant Human NKG2D Ligand 2, NKG2DL2, N2DL2 (C-Fc) 10 µg 146 € novo human
CK78 Recombinant Human NKG2D Ligand 1, NKG2DL, ULBP1 (C-6His) 10 µg 146 € novo human
CK50 Recombinant Human NKG2D Ligand 1, NKG2DL, ULBP1 (C-Fc) 1 mg 1877 € novo human
CJ87 Recombinant Mouse NKG2D Ligand 1, NKG2DL, ULBP1 (C-6His) 500 µg 1115 € novo mouse
abx251525 Anti-Human NKG2D ligand 2 ELISA Kit 96 tests 659 € abbex human
MBS612868 APRIL, ED2 (a Proliferation Inducing Ligand, TALL-2, TNF and ApoL-related Leukocyte-expressed Ligand 2, TRDL-1a, TNF-related Death Ligand 1a, TNFSF13) Antibody 100ug 569 € MBS Polyclonals_1 human
AR50555PU-N anti-ULBP1 / NKG2D ligand 1 (26-216, His-tag) Antibody 0,5 mg 1109 € acr human
AR50555PU-S anti-ULBP1 / NKG2D ligand 1 (26-216, His-tag) Antibody 0,1 mg 485 € acr human
AR50416PU-N anti-ULBP2 / NKG2D ligand 2 (26-216, His-tag) Antibody 0,5 mg 1109 € acr human
AR50416PU-S anti-ULBP2 / NKG2D ligand 2 (26-216, His-tag) Antibody 0,1 mg 485 € acr human
CP46 Recombinant Human NKG2-D type II Integral Membrane Protein, NKG2D, CD314 (N-6His) 10 µg 146 € novo human
RP-1126H Recombinant Human NKG2D / CD314 Protein (aa 78-216, His Tag) 50μg 624 € adv human
RP-1133RC Recombinant Rhesus NKG2D / KLRK1 Protein (aa 78-216, His Tag) 50μg 624 € adv rhesus
101-M585 Anti-Human NKG2D 100ug 336 € Reliatech antibodies human
MBS619083 BCA-1 (B Cell Attracting Chemokine 1, BCA1, B Lymphocyte Chemoattractant, ANGIE, ANGIE2, BLC, BLR1 Ligand, BLR1L, Chemokine (C-X-C Motif) Ligand 13 (B-cell Chemoattractant), C-X-C Motif Chemokine 13, CXCL13, CXC Chemokine BLC, Small Inducible Cytokine B S Antibody 50ug 774 € MBS Polyclonals_1 human
MBS611262 Ephrin B2 (EPH-related receptor tyrosine kinase ligand 5, Ephrin-B2, EFNB2, EPLG5, HTK-L, HTK ligand, LERK5) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS614848 Ephrin B2 (EPH-related receptor tyrosine kinase ligand 5, Ephrin-B2, EFNB2, EPLG5, HTK-L, HTK ligand, LERK5) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS615500 Ephrin B3 (EFNB3, Ephrin B3 (EFL6, EPH-related receptor transmembrane ligand ELK-L3, EPH-related receptor tyrosine kinase ligand 8, Ephrin-B3, EPLG8, LERK8) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS613189 sRANKL (soluble RANK Ligand, Receptor Activator of NFkB Ligand) 50ug 426 € MBS Polyclonals_1 human
MBS610394 sRANKL (soluble RANK Ligand, Receptor Activator of NFkB Ligand) Antibody 50ug 426 € MBS Polyclonals_1 human
MBS612269 sRANKL (soluble RANK Ligand, Receptor Activator of NFkB Ligand) Antibody 100ug 730 € MBS Polyclonals_1 human
MBS615307 sRANKL (soluble RANK Ligand, Receptor Activator of NFkB Ligand) Antibody 50ug 426 € MBS Polyclonals_1 human
MBS618763 sRANKL (soluble RANK Ligand, Receptor Activator of NFkB Ligand) (Biotin) 0.025 miligrams 426 € MBS Polyclonals_1 human
MBS618814 sRANKL (soluble RANK Ligand, Receptor Activator of NFkB Ligand) (Biotin) 50ug 464 € MBS Polyclonals_1 human
MBS610170 sRANKL (soluble RANK Ligand, Receptor Activator of NFkB Ligand) (Biotin) Antibody 50ug 464 € MBS Polyclonals_1 human
MBS618763 sRANKL (soluble RANK Ligand, Receptor Activator of NFkB Ligand) (Biotin) Antibody 50ug 464 € MBS Polyclonals_1 human
MBS618814 sRANKL (soluble RANK Ligand, Receptor Activator of NFkB Ligand) (Biotin) Antibody 0.025 miligrams 426 € MBS Polyclonals_1 human
MBS623376 Thrombopoietin, ID (TPO, Megakaryocyte Colony-stimulating Factor, Myeloproliferative Leukemia Virus Oncogene Ligand, C-mpl Ligand, ML, Megakaryocyte Growth And Development Factor, MGDF, THPO) Antibody 200ul 603 € MBS Polyclonals_1 virus
MBS611323 TWEAK (TNF-related Weak Inducer of Apoptosis, APO3 Ligand, APO3/DR3 Ligand, APO3L, CD255, DR3LG, FN14, HCG1991317, MGC129581, MGC20669, Tumor Necrosis Factor Ligand Superfamily Member 12, TNFSF12, UNQ181/PRO207) Antibody 50ug 426 € MBS Polyclonals_1 human