| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human TREML1 is produced by our Mammalian expression system and the target gene encoding Gln16-Pro162 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
42, 9 kD |
| UniProt number: |
Q86YW5 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
TLT-1 (C-Fc), TREML1 |
| Short name: |
TLT-1 (C-Fc), Recombinant TREML1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
TLT-1 (C-fragment c), sapiens triggering receptor expressed on myeloid cells-like 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Cell surfaces, TREML1 and IDBG-630847 and ENSBTAG00000006485 and 784711, TREML1 and IDBG-86561 and ENSG00000161911 and 340205, Treml1 and IDBG-189902 and ENSMUSG00000023993 and 71326, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019722 and calcium-mediated signaling and biological process this GO :0030168 and platelet activation and biological process this GO :0031091 and platelet alpha granule and cellular component this GO :0045087 and innate immune response and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, triggering receptor expressed on myeloid cells-like 1 |
| Identity: |
20434 |
| Gene: |
TREML1 |
More about : TREML1 |
| Long gene name: |
triggering receptor expressed on myeloid cells like 1 |
| Synonyms gene name: |
triggering receptor expressed on myeloid cells-like 1 |
| Synonyms: |
TLT1 dJ238O23, 3 |
| Synonyms name: |
TREM-like transcript 1 |
| Locus: |
6p21, 1 |
| Discovery year: |
2003-07-08 |
| GenBank acession: |
AF534822 |
| Entrez gene record: |
340205 |
| Pubmed identfication: |
12393607 12645956 |
| RefSeq identity: |
NM_178174 |
| Classification: |
V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000016231 |