Recombinant Human B- and T-Lymphocyte Attenuator, BTLA, CD272 (C-Fc)

Contact us
Catalog number: CD06
Price: 2862 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human B- and T-Lymphocyte Attenuator, BTLA, CD272 (C-Fc)
Quantity: 1000ug
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human BTLA is produced by our Mammalian expression system and the target gene encoding Lys31-Leu150 is expressed with a Fc tag at the C-terminus
Molecular Weight: 40, 8 kD
UniProt number: Q7Z6A9
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BTLA, CD272 (C-Fc), B T-Lymphocyte Attenuator
Short name: BTLA, CD272 (C-Fc), Recombinant B- T-Lymphocyte Attenuator
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: B and T lymphocyte associated, CD272 (C-fragment c), sapiens B- and T-Lymphocyte Attenuator, recombinant H
Alternative technique: rec
Alternative to gene target: BTLA and IDBG-49858 and ENSG00000186265 and 151888, BTLA and IDBG-632288 and ENSBTAG00000011871 and 531767, Btla and IDBG-162900 and ENSMUSG00000052013 and 208154, Cell surfaces, protein binding, this GO :0002768 and immune response-regulating cell surface receptor signaling pathway and biological process this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0030889 and negative regulation of B cell proliferation and biological process this GO :0031295 and T cell costimulation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0046642 and negative regulation of alpha-beta T cell proliferation and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, B and T lymphocyte associated
Identity: 21087
Gene: BTLA | More about : BTLA
Long gene name: B and T lymphocyte associated
Synonyms: BTLA1 CD272
Locus: 3q13, 2
Discovery year: 2003-08-20
GenBank acession: AY293286
Entrez gene record: 151888
Pubmed identfication: 12796776
RefSeq identity: NM_181780
Classification: Immunoglobulin like domain containing CD molecules
Havana BLAST/BLAT: OTTHUMG00000159255

Related Products :

MBS619725 BTLA (B and T lymphocyte associated, BTLA1, CD272, FLJ16065, MGC129743, B and T lymphocyte attenuator) 100ug 547 € MBS Polyclonals_1 human
C563 Recombinant Human B- and T-Lymphocyte Attenuator, BTLA, CD272 (C-6His) 500 µg 1613 € novo human
CD06 Recombinant Human B- and T-Lymphocyte Attenuator, BTLA, CD272 (C-Fc) 1 mg 2486 € novo human
GENTAUR-58bd7ecbaa23f Rat B- and T-lymphocyte attenuator (Btla) 100ug 1509 € MBS Recombinant Proteins rat
GENTAUR-58bd7ecc0ff52 Rat B- and T-lymphocyte attenuator (Btla) 1000ug 1509 € MBS Recombinant Proteins rat
GENTAUR-58bd7ecc79649 Rat B- and T-lymphocyte attenuator (Btla) 100ug 2011 € MBS Recombinant Proteins rat
GENTAUR-58bd7ecce0cbe Rat B- and T-lymphocyte attenuator (Btla) 1000ug 2011 € MBS Recombinant Proteins rat
PRO-50024-0010 anti-CD272 / BTLA (25-289) Antibody 10 Вµg 268 € acr human
PRO-50024-0025 anti-CD272 / BTLA (25-289) Antibody 25 Вµg 413 € acr human
PRO-50024-0050 anti-CD272 / BTLA (25-289) Antibody 50 Вµg 616 € acr human
AM05617PU-L anti-CD272 / BTLA Antibody 0,2 mg 746 € acr human
AM05617PU-N anti-CD272 / BTLA Antibody 0,1 mg 456 € acr human
MBS620004 BLAME (B-lymphocyte activator macrophage expressed, Lymphocyte Activator Macrophage Expressed, Slam family member 8, SLAM-8, SLAMF8) Antibody 100ug 564 € MBS Polyclonals_1 human
abx169579 Anti-BTLA Protein (Recombinant) 10 µg 311 € abbex human
RP-1055M Recombinant Mouse BTLA Protein (Fc Tag) 50μg 624 € adv mouse
RP-2016R Recombinant Rat BTLA Protein (ECD, Fc Tag) 50μg 624 € adv rat
RP-1018RC Recombinant Rhesus BTLA Protein (Fc Tag) 50μg 624 € adv rhesus
GENTAUR-58bd0555c51ca Bacillus subtilis Tryptophan RNA-binding attenuator protein inhibitory protein (rtpA) 100ug 1243 € MBS Recombinant Proteins human
GENTAUR-58bd055622b9f Bacillus subtilis Tryptophan RNA-binding attenuator protein inhibitory protein (rtpA) 1000ug 1243 € MBS Recombinant Proteins human
GENTAUR-58bd05567197e Bacillus subtilis Tryptophan RNA-binding attenuator protein inhibitory protein (rtpA) 100ug 1752 € MBS Recombinant Proteins human
GENTAUR-58bd0556ade49 Bacillus subtilis Tryptophan RNA-binding attenuator protein inhibitory protein (rtpA) 1000ug 1752 € MBS Recombinant Proteins human
GENTAUR-58bcaa59d23e4 Neurospora crassa Arginine attenuator peptide (NCU07732-A) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bcaa5a2c0f9 Neurospora crassa Arginine attenuator peptide (NCU07732-A) 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58bcf88cdf37b Saccharomyces cerevisiae Arginine attenuator peptide (YOR302W) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bcf88d39016 Saccharomyces cerevisiae Arginine attenuator peptide (YOR302W) 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58b8f60ba095c Salmonella typhimurium Intracellular growth attenuator protein igaA (igaA) 1000ug 2862 € MBS Recombinant Proteins salmonella
GENTAUR-58b8f60bd9c10 Salmonella typhimurium Intracellular growth attenuator protein igaA (igaA) 1000ug 3365 € MBS Recombinant Proteins salmonella
GENTAUR-58b9f24ab36f6 Salmonella typhimurium Intracellular growth attenuator protein igaA (igaA) 1000ug 2862 € MBS Recombinant Proteins salmonella
GENTAUR-58b9f24b7371d Salmonella typhimurium Intracellular growth attenuator protein igaA (igaA) 1000ug 3365 € MBS Recombinant Proteins salmonella
GENTAUR-58bc76377aa72 Salmonella typhimurium Intracellular growth attenuator protein igaA (igaA) 1000ug 2862 € MBS Recombinant Proteins salmonella