| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human BTLA is produced by our Mammalian expression system and the target gene encoding Lys31-Leu150 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
40, 8 kD |
| UniProt number: |
Q7Z6A9 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BTLA, CD272 (C-Fc), B T-Lymphocyte Attenuator |
| Short name: |
BTLA, CD272 (C-Fc), Recombinant B- T-Lymphocyte Attenuator |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
B and T lymphocyte associated, CD272 (C-fragment c), sapiens B- and T-Lymphocyte Attenuator, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BTLA and IDBG-49858 and ENSG00000186265 and 151888, BTLA and IDBG-632288 and ENSBTAG00000011871 and 531767, Btla and IDBG-162900 and ENSMUSG00000052013 and 208154, Cell surfaces, protein binding, this GO :0002768 and immune response-regulating cell surface receptor signaling pathway and biological process this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0030889 and negative regulation of B cell proliferation and biological process this GO :0031295 and T cell costimulation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0046642 and negative regulation of alpha-beta T cell proliferation and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, B and T lymphocyte associated |
| Identity: |
21087 |
| Gene: |
BTLA |
More about : BTLA |
| Long gene name: |
B and T lymphocyte associated |
| Synonyms: |
BTLA1 CD272 |
| Locus: |
3q13, 2 |
| Discovery year: |
2003-08-20 |
| GenBank acession: |
AY293286 |
| Entrez gene record: |
151888 |
| Pubmed identfication: |
12796776 |
| RefSeq identity: |
NM_181780 |
| Classification: |
Immunoglobulin like domain containing CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000159255 |