Recombinant Human CTHRC1, NMTC1 (C-6His)

Contact us
Catalog number: CC98
Price: 365 €
Supplier: MBS Polyclonals
Product name: Recombinant Human CTHRC1, NMTC1 (C-6His)
Quantity: 50ug
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CTHRC1 is produced by our Mammalian expression system and the target gene encoding Ser31-Lys243 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 24
UniProt number: Q96CG8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPKVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: NMTC1 (C-6His), CTHRC1
Short name: NMTC1 (C-6His), Recombinant CTHRC1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: NMTC1 (C-6His), sapiens CTHRC1, recombinant H
Alternative technique: rec
Identity: 18831
Gene: CTHRC1 | More about : CTHRC1
Long gene name: collagen triple helix repeat containing 1
Locus: 8q22, 3
Discovery year: 2002-07-22
GenBank acession: BC014245
Entrez gene record: 115908
Pubmed identfication: 15618538
RefSeq identity: NM_138455
Havana BLAST/BLAT: OTTHUMG00000164887

Related Products :

CC98 Recombinant Human CTHRC1, NMTC1 (C-6His) 50 µg 496 € novo human
RP-0507H Recombinant Human CTHRC1 Protein (His Tag) 10μg 572 € adv human
abx166217 Anti-CTHRC1 Protein (Recombinant) 10 μg 427 € abbex human
RP-2107R Recombinant Rat CTHRC1 Protein (His Tag) 20μg 572 € adv rat
abx151201 Anti-Human CTHRC1 ELISA Kit inquire 50 € abbex human
abx573931 Anti-Human CTHRC1 ELISA Kit inquire 50 € abbex human
LV129551 CTHRC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV129552 CTHRC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV129553 CTHRC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV129554 CTHRC1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV129556 CTHRC1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV129555 CTHRC1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
DL-CTHRC1-Hu Human Collagen Triple Helix Repeat Containing Protein 1 CTHRC1 ELISA Kit 96T 974 € DL elisas human
AP50160HU-100ug Human CTHRC1 Protein 0.1mg 184 € abebio human
AP50160HU-1mg Human CTHRC1 Protein 1mg 604 € abebio human
GENTAUR-58bde8482c882 Mouse Monoclonal [clone 1G12] (IgG2a,k) to Human CTHRC1 Antibody 50ug 663 € MBS mono human
PRO-50050-0010 anti-CTHRC1 (31-243) Antibody 10 Вµg 297 € acr human
PRO-50050-0025 anti-CTHRC1 (31-243) Antibody 25 Вµg 456 € acr human
PRO-50050-0050 anti-CTHRC1 (31-243) Antibody 50 Вµg 703 € acr human
AR51822PU-N anti-CTHRC1 (31-243, His-tag) Antibody 0,5 mg 1109 € acr human
AR51822PU-S anti-CTHRC1 (31-243, His-tag) Antibody 0,1 mg 485 € acr human
AM33393PU-N anti-CTHRC1 (32-142) Antibody 50 Вµg 819 € acr human
PRO-50005-0020 anti-CTHRC1 (32-243) Antibody 20 Вµg 297 € acr human
PRO-50005-0050 anti-CTHRC1 (32-243) Antibody 50 Вµg 456 € acr human
PRO-50005-0100 anti-CTHRC1 (32-243) Antibody 0,1 mg 703 € acr human
GENTAUR-58bdf89121ff9 Anti- CTHRC1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf89184699 Anti- CTHRC1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be42efb0fae Anti- CTHRC1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be46b804922 Anti- CTHRC1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be54c3d5c16 Anti- CTHRC1 Antibody 50ug 365 € MBS Polyclonals human