Recombinant Human Creatine Kinase, Muscle, CKMM (C-6His)

Contact us
Catalog number: CC96
Price: 804 €
Supplier: abbex
Product name: Recombinant Human Creatine Kinase, Muscle, CKMM (C-6His)
Quantity: 96 tests
Other quantities: 1 mg 1674€ 10 µg 95€ 500 µg 1186€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CKMM is produced by our Mammalian expression system and the target gene encoding Met1-Lys381 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 44
UniProt number: P06732
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10%Glycerol, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CKMM (C-6His), Muscle, Creatine Kinase
Short name: CKMM (C-6His), Muscle, Recombinant Creatine Kinase
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CKMM (C-6His), Muscle, sapiens Creatine phosphorylation catalyst, recombinant H
Alternative technique: rec
Identity: 1994
Gene: CKM | More about : CKM
Long gene name: M-type , creatine kinase
Synonyms gene: CKMM
Synonyms gene name: creatine kinase, muscle
Locus: 19q13, 32
Discovery year: 2001-06-22
GenBank acession: M14780
Entrez gene record: 1158
Havana BLAST/BLAT: OTTHUMG00000181782

Related Products :

CC96 Recombinant Human Creatine Kinase, Muscle, CKMM (C-6His) 10 µg 95 € novo human
MBS611795 MuSK (Muscle/Skeletal Receptor Tyrosine Protein Kinase, Muscle Skeletal Receptor Tyrosine Kinase, MDK4, MGC126323, MGC126324, Muscle Specific Kinase Receptor, Muscle Specific Tyrosine Kinase Receptor, Muscle Specific Tyrosine Protein Kinase Receptor, Neur Antibody 200ul 735 € MBS Polyclonals_1 human
MBS623702 CKBB, NT (Creatine Kinase B-type, Creatine Kinase B Chain, B-CK, CKB) Antibody 200ul 603 € MBS Polyclonals_1 human
GWB-B5BFE8 Muscle specificity Ring Finger protein 1; Striated Muscle RING Zinc Finger protein; Muscle specificity Ring Finger protein 2; Iris Rin 1 vial 602 € genways human
GWB-D6DB18 Muscle specificity Ring Finger protein 1; Striated Muscle RING Zinc Finger protein; Muscle specificity Ring Finger protein 2; Iris Rin 1 vial 602 € genways human
abx573803 Anti-Human Creatine Kinase, Muscle (CKM) ELISA Kit 96 tests 731 € abbex human
DL-CKM-Hu Human Creatine Kinase, Muscle CKM ELISA Kit 96T 846 € DL elisas human
abx575361 Anti-Chicken Creatine Kinase, Muscle (CKM) ELISA Kit 96 tests 775 € abbex chicken
abx574280 Anti-Cow Creatine Kinase, Muscle (CKM) ELISA Kit inquire 50 € abbex cow
GENTAUR-58bdc13681d57 Anti- Creatine Kinase, Muscle (CKM) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc13717b9a Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc42f9af5f Anti- Creatine Kinase, Muscle (CKM) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc43012155 Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc5ad184f5 Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdc6b92529c Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdca910fe54 Anti- Creatine Kinase, Muscle (CKM) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdca916425d Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcbe4c2998 Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdcc5c203b4 Anti- Creatine Kinase, Muscle (CKM) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcc5c7ff7e Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdcef009622 Anti- Creatine Kinase, Muscle (CKM) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdcef05f257 Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdcfc69dd70 Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd28adf962 Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd8dd2c7f7 Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 597 € MBS Polyclonals human
GENTAUR-58bdd9214e24a Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddc7048257 Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddcc449434 Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bddd15bfd9b Anti- Creatine Kinase, Muscle (CKM) Antibody 100ug 531 € MBS Polyclonals human
abx575939 Anti-Dog Creatine Kinase, Muscle (CKM) ELISA Kit 96 tests 804 € abbex dog