Recombinant Human Interferon ω-1, IFNW1 (C-6His)

Contact us
Catalog number: CC87
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human Interferon ω-1, IFNW1 (C-6His)
Quantity: 0.1ml
Other quantities: 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interferon omega-1 is produced by our Mammalian expression system and the target gene encoding Leu22-Ser195 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 21
UniProt number: P05000
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IFNW1 (C-6His), -1, Interferon &omega
Short name: IFNW1 (C-6His), -1, Recombinant Interferon &omega
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: interferon, omega 1 (C-6His), sapiens Interferon &omega, -1, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, IFNW1 and IDBG-53542 and ENSG00000177047 and 3467, omega 1, this GO :0002250 and adaptive immune response and biological process this GO :0002286 and T cell activation involved in immune response and biological process this GO :0002323 and natural killer cell activation involved in immune response and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005126 and cytokine receptor binding and molecular function this GO :0005132 and type I interferon receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006952 and defense response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0009615 and response to virus and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030183 and B cell differentiation and biological process this GO :0033141 and positive regulation of peptidyl-serine phosphorylation of STAT protein and biological process this GO :0042100 and B cell proliferation and biological process this GO :0043330 and response to exogenous dsRNA and biological process this GO :0045087 and innate immune response and biological process this GO :0045343 and regulation of MHC class I biosynthetic process and biological process this GO :0051607 and defense response to virus and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005126 : cytokine receptor binding and also this GO :0005132 : type I interferon receptor binding, this GO :0005126 : cytokine receptor binding, this GO :0005132 : type I interferon receptor binding, type I interferon receptor binding, interferon
Identity: 5448
Gene: IFNW1 | More about : IFNW1
Long gene name: interferon omega 1
Synonyms name: IFN-omega 1, interferon omega-1
Locus: 9p21, 3
Discovery year: 1992-11-06
Entrez gene record: 3467
Pubmed identfication: 1385305
RefSeq identity: NM_002177
Classification: Interferons
Havana BLAST/BLAT: OTTHUMG00000019656

Related Products :

CC87 Recombinant Human Interferon ω-1, IFNW1 (C-6His) 500 µg 1613 € novo human
AR31099PU-N anti-IFNW1 / Interferon omega-1 Antibody 0,1 mg 384 € acr human
AR31099PU-S anti-IFNW1 / Interferon omega-1 Antibody 20 Вµg 253 € acr human
CPA1577-100ul anti-IFNW1 / Interferon omega-1 Antibody 0,1 ml 442 € acr human
CPA1577-200ul anti-IFNW1 / Interferon omega-1 Antibody 0,2 ml 688 € acr human
CPA1577-30ul anti-IFNW1 / Interferon omega-1 Antibody 30 Вµl 326 € acr human
PBL11395-1 anti-IFNW1 / Interferon omega-1 Antibody 25 Вµg 601 € acr human
MBS610191 Fragilis (1 8U, Ifitm3, Interferon Induced Transmembrane Protein 3, Interferon inducible protein 1 8U, Interferon Inducible Protein 15, Interferon Inducible Protein Homolog) Antibody 100ug 558 € MBS Polyclonals_1 human
PBL41395-1 anti-Interferon-omega (IFN-omega) (human) ELISA Kit Antibody 96 Tests 1065 € acr human
MBS612461 Interferon Stimulating Gene 15 (ISG15, 15kD Ubiquitin-like Modifier GIP2, G1P2, Interferon Induced 15kD Protein, IFI15, Interferon alpha Inducible Protein, Interferon Stimulated Protein 15kD, Ubiquitin Cross-reactive Protein, UCRP) Antibody 500ug 829 € MBS Polyclonals_1 human
GWB-BSP043 IFNW1 Human Protein bulk Ask price € genways bulk human
LV186453 IFNW1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
LV186454 IFNW1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV186455 IFNW1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV186456 IFNW1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV186458 IFNW1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 517 € ABM lentivectors human
LV186457 IFNW1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 517 € ABM lentivectors human
abx216272 Anti-IFNW1 Antibody inquire 50 € abbex human
GENTAUR-58be5f44230e6 Anti-IFNW1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx920256 Anti-IFNW1 siRNA inquire 50 € abbex human
bs-15525R-A350 IFNW1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-15525R-A488 IFNW1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-15525R-A555 IFNW1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-15525R-A594 IFNW1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-15525R-A647 IFNW1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-15525R-Biotin IFNW1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-15525R IFNW1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-15525R-Cy3 IFNW1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-15525R-Cy5 IFNW1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-15525R-Cy5.5 IFNW1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human