Recombinant Human Apolipoprotein A-II, ApoA2 (C-6His)

Contact us
Catalog number: CC76
Price: 804 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Human Apolipoprotein A-II, ApoA2 (C-6His)
Quantity: 1 plate of 96 wells
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Apolipoprotein A-II is produced by our Mammalian expression system and the target gene encoding Gln24-Gln100 is expressed with a 6His tag at the C-terminus
Molecular Weight: 74 kD, 9
UniProt number: P02652
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ApoA2 (C-6His), Apolipoprotein A-II
Short name: ApoA2 (C-6His), Recombinant Apolipoprotein A-II
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: apolipoprotein A-II (C-6His), sapiens Apolipoprotein A-II, recombinant H
Alternative technique: rec

Related Products :

CC76 Recombinant Human Apolipoprotein A-II, ApoA2 (C-6His) 1 mg 2486 € novo human
abx575967 Anti-Human Apolipoprotein A2 (APOA2) ELISA Kit inquire 50 € abbex human
GWB-E2F7F2 Apolipoprotein A-ii (APOA2) Goat antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
MBS242062 Goat Polyclonal (IgG) to Human APOA2 / Apolipoprotein A II Antibody 0.05 ml 597 € MBS Polyclonals_1 human
MBS246704 Goat Polyclonal to Human APOA2 / Apolipoprotein A II Antibody 0.25 miligrams 597 € MBS Polyclonals_1 human
DL-APOA2-Hu Human Apolipoprotein A2 APOA2 ELISA Kit 96T 846 € DL elisas human
GENTAUR-58bde7fa097fa Mouse Monoclonal [clone 1H6] (IgG1,k) to Human APOA2 / Apolipoprotein A II Antibody 50ug 663 € MBS mono human
GENTAUR-58bde6ce6524e Mouse Monoclonal [clone 4F3] (IgG1,k) to Human APOA2 / Apolipoprotein A II Antibody 50ug 663 € MBS mono human
MBS242643 PAb (IgG) to Human APOA2 / Apolipoprotein A II Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bdc8a0051b6 Anti- Apolipoprotein A2 (APOA2) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdce8a7d048 Anti- Apolipoprotein A2 (APOA2) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdce8b03ad8 Anti- Apolipoprotein A2 (APOA2) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcf9cc9c70 Anti- Apolipoprotein A2 (APOA2) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdcf9d1f54a Anti- Apolipoprotein A2 (APOA2) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd06a41c82 Anti- Apolipoprotein A2 (APOA2) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd0dca21a6 Anti- Apolipoprotein A2 (APOA2) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd0dd0937b Anti- Apolipoprotein A2 (APOA2) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdd33ce55c3 Anti- Apolipoprotein A2 (APOA2) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd5a86b873 Anti- Apolipoprotein A2 (APOA2) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd72f40c23 Anti- Apolipoprotein A2 (APOA2) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd8be8d8a5 Anti- Apolipoprotein A2 (APOA2) Antibody 100ug 597 € MBS Polyclonals human
abx576098 Anti-Mouse Apolipoprotein A2 (APOA2) ELISA Kit 96 tests 746 € abbex mouse
abx575769 Anti-Pig Apolipoprotein A2 (APOA2) ELISA Kit inquire 50 € abbex pig
abx575871 Anti-Rat Apolipoprotein A2 (APOA2) ELISA Kit inquire 50 € abbex rat
F50393-0.08ML APOA2 Antibody (Apolipoprotein A-II) 0.08 ml 199 € NJS poly human
F52381-0.08ML APOA2 Antibody (Apolipoprotein A-II) 0.08 ml 199 € NJS poly human
EKU02487 Apolipoprotein A2 (APOA2) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU02488 Apolipoprotein A2 (APOA2) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human
EKU02489 Apolipoprotein A2 (APOA2) ELISA kit 1 plate of 96 wells 883 € Biomatik ELISA kits human
EKU02490 Apolipoprotein A2 (APOA2) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human