Recombinant Human Low-Density Lipoprotein Receptor, LDLR (C-6His, AVI)

Contact us
Catalog number: CC70
Price: 2017 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Low-Density Lipoprotein Receptor, LDLR (C-6His, AVI)
Quantity: 1000ug
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human LDL Receptor is produced by our Mammalian expression system and the target gene encoding Ala22-Arg788 is expressed with a AVI
Molecular Weight: 1 kD, 90
UniProt number: P01130
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 50 mM HEPES, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVRGLNDIFEAQKIEWHELENLYFQGHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: AVI), LDLR (C-6His, Lipoprotein Receptor
Short name: AVI), LDLR (C-6His, Recombinant Low-Density Lipoprotein Receptor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: AVI), low density lipoprotein receptor (C-6His, sapiens Low-Density Lipoprotein Receptor, recombinant H
Alternative technique: rec
Alternative to gene target: Cell surfaces, FH and FHC and LDLCQ2, LDLR and IDBG-28808 and ENSG00000130164 and 3949, LDLR and IDBG-643476 and ENSBTAG00000012314 and 281276, Ldlr and IDBG-141358 and ENSMUSG00000032193 and 16835, this GO :0001523 and retinoid metabolic process and biological process this GO :0001948 and glycoprotein binding and molecular function this GO :0005041 and low-density lipoprotein receptor activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005764 and lysosome and cellular component this GO :0005768 and endosome and cellular component this GO :0005769 and early endosome and cellular component this GO :0005770 and late endosome and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005905 and coated pit and cellular component this GO :0006629 and lipid metabolic process and biological process this GO :0006897 and endocytosis and biological process this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0007603 and phototransduction, this GO :0001948 : glycoprotein binding, this GO :0001948 : glycoprotein binding and also this GO :0005041 : low-density lipoprotein receptor activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0030169 : low-density lipoprotein particle binding and also this GO :0030229 : very-low-density lipoprotein particle receptor activity, this GO :0005041 : low-density lipoprotein receptor activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0030169 : low-density lipoprotein particle binding, this GO :0030229 : very-low-density lipoprotein particle receptor activity, very-low-density lipoprotein particle receptor activity, visible light and biological process this GO :0008203 and cholesterol metabolic process and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010008 and endosome membrane and cellular component this GO :0010867 and positive regulation of triglyceride biosynthetic process and biological process this GO :0010899 and regulation of phosphatidylcholine catabolic process and biological process this GO :0015914 and phospholipid transport and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0030169 and low-density lipoprotein particle binding and molecular function this GO :0030229 and very-low-density lipoprotein particle receptor activity and molecular function this GO :0030299 and intestinal cholesterol absorption and biological process this GO :0030301 and cholesterol transport and biological process this GO :0030669 and clathrin-coated endocytic vesicle membrane and cellular component this GO :0034362 and low-density lipoprotein particle and cellular component this GO :0034383 and low-density lipoprotein particle clearance and biological process this GO :0042157 and lipoprotein metabolic process and biological process this GO :0042159 and lipoprotein catabolic process and biological process this GO :0042632 and cholesterol homeostasis and biological process this GO :0043235 and receptor complex and cellular component this GO :0044281 and small molecule metabolic process and biological process this GO :0070508 and cholesterol import and biological process this GO :2000188 and regulation of cholesterol homeostasis and biological process, low density lipoprotein receptor
Identity: 6547
Gene: LDLR | More about : LDLR
Long gene name: low density lipoprotein receptor
Synonyms: LDLCQ2
Synonyms name: familial hypercholesterolemia
Locus: 19p13, 2
Discovery year: 1986-01-01
GenBank acession: AY114155
Entrez gene record: 3949
Classification: Low density lipoprotein receptors
Havana BLAST/BLAT: OTTHUMG00000171935
Locus Specific Databases: Familial UMD Locus Specific Databases British Heart Foundation LRG_274 , Hypercholesterolemia

Related Products :

CC70 Recombinant Human Low-Density Lipoprotein Receptor, LDLR (C-6His, AVI) 1 mg 2486 € novo human
MBS619377 SORL1 (Sortilin-related Receptor L(DLR class) A Repeats Containing, gp250, Low Density Lipoprotein Receptor Relative with 11 Ligand Binding Repeats, LDLR Relative with 11 Ligand Binding Repeats, LR11, LRP9, Mosaic Protein LR11, SorLA-1, Sortilin-related R 100ug 735 € MBS Polyclonals_1 human
CA88 Recombinant Human Low-Density Lipoprotein Receptor, LDLR (C-6His) 50 µg 359 € novo human
DL-LDLR-Hu Human Low Density Lipoprotein Receptor LDLR ELISA Kit 96T 869 € DL elisas human
AE35818RB-48 ELISA test for Rabbit Low-density lipoprotein receptor (LDLR) 1x plate of 48 wells 402 € abebio human
GWB-19256D Low Density Lipoprotein Receptor (LDLR), antibody 1 x 1 vial 879 € genways human
EKU05677 Low Density Lipoprotein Receptor (LDLR) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU05678 Low Density Lipoprotein Receptor (LDLR) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
GWB-4CD9A7 Low Density Lipoprotein Receptor (LDLR) Rabbit antibody to or anti-Mouse Polyclonal (aa499-511) antibody 1 x 1 vial 872 € genways mouse
DL-LDLR-Mu Mouse Low Density Lipoprotein Receptor LDLR ELISA Kit 96T 904 € DL elisas mouse
AE35818RB Rabbit Low-density lipoprotein receptor (LDLR) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE35818RB-96 Rabbit Low-density lipoprotein receptor (LDLR) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58b9ee2648f17 Rat Low-density lipoprotein receptor (Ldlr) 100ug 3072 € MBS Recombinant Proteins rat
GENTAUR-58b9ee26c643b Rat Low-density lipoprotein receptor (Ldlr) 1000ug 3072 € MBS Recombinant Proteins rat
GENTAUR-58b9ee2755ac2 Rat Low-density lipoprotein receptor (Ldlr) 100ug 3580 € MBS Recombinant Proteins rat
GENTAUR-58b9ee27e9257 Rat Low-density lipoprotein receptor (Ldlr) 1000ug 3580 € MBS Recombinant Proteins rat
C389 Recombinant Human Low-Density Lipoprotein Receptor Related Protein 12, LRP12 (C-6His) 500 µg 1613 € novo human
C524 Recombinant Human Oxidized Low-Density Lipoprotein Receptor 1, OLR1 (C-6His) 1 mg 2283 € novo human
GENTAUR-58bc3e558b99e Agrobacterium vitis Putative phosphotransferase Avi_0001 (Avi_0001) 100ug 1801 € MBS Recombinant Proteins human
GENTAUR-58bc3e55ba33f Agrobacterium vitis Putative phosphotransferase Avi_0001 (Avi_0001) 1000ug 1801 € MBS Recombinant Proteins human
GENTAUR-58bc3e5609fdf Agrobacterium vitis Putative phosphotransferase Avi_0001 (Avi_0001) 100ug 2315 € MBS Recombinant Proteins human
GENTAUR-58bc3e564d1ff Agrobacterium vitis Putative phosphotransferase Avi_0001 (Avi_0001) 1000ug 2315 € MBS Recombinant Proteins human
GENTAUR-58ba800774e87 Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 100ug 1520 € MBS Recombinant Proteins human
GENTAUR-58ba800801f0c Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 1000ug 1520 € MBS Recombinant Proteins human
GENTAUR-58ba8008afbe7 Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 100ug 2022 € MBS Recombinant Proteins human
GENTAUR-58ba80091fa97 Agrobacterium vitis UPF0260 protein Avi_1324 (Avi_1324) 1000ug 2022 € MBS Recombinant Proteins human
GENTAUR-58bb7cbe41859 Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 100ug 1514 € MBS Recombinant Proteins human
GENTAUR-58bb7cbe8bc2f Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 1000ug 1514 € MBS Recombinant Proteins human
GENTAUR-58bb7cbedf9ed Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 100ug 2017 € MBS Recombinant Proteins human
GENTAUR-58bb7cbf1f619 Agrobacterium vitis UPF0262 protein Avi_0642 (Avi_0642) 1000ug 2017 € MBS Recombinant Proteins human