Recombinant Mouse Interleukin-17F, IL-17F (C-6His)

Contact us
Catalog number: CC11
Price: 384 €
Supplier: acr
Product name: Recombinant Mouse Interleukin-17F, IL-17F (C-6His)
Quantity: 25 Вµg
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interleukin-17F is produced by our Mammalian expression system and the target gene encoding Arg29-Ala161 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15, 9 kD
UniProt number: Q7TNI7
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-17F (C-6His), Interleukin-17F
Short name: IL-17F (C-6His), Recombinant Mouse Interleukin-17F
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Interleukin-17F (C-6His), recombinant Mouse Interleukin-17F
Alternative technique: rec
Identity: 16404
Gene: IL17F | More about : IL17F
Long gene name: interleukin 17F
Synonyms: IL-17F ML-1 ML1
Locus: 6p12, 2
Discovery year: 2002-03-18
GenBank acession: AF384857
Entrez gene record: 112744
Pubmed identfication: 11591732 11591768
RefSeq identity: NM_052872
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000014845
Locus Specific Databases: LRG_356

Related Products :

CC11 Recombinant Mouse Interleukin-17F, IL-17F (C-6His) 500 µg 1613 € novo mouse
CA22 Recombinant Human Interleukin-17F, IL-17F (C-6His) 50 µg 369 € novo human
C030 Recombinant Human Interleukin-17F, IL-17F 500 µg 1613 € novo human
CS27 Recombinant Human Interleukin-17F, IL-17F (Human Cells) 10 µg 156 € novo human
MBS619613 Interleukin 17F (IL-17F) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS620833 Interleukin 17F (IL-17F) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS622149 Interleukin 17F (IL-17F) (Biotin) Antibody 50ug 464 € MBS Polyclonals_1 human
CI60 Recombinant Human Interleukin-17A, F Heterodimer, IL-17A & IL-17F (C-6His) 1 mg 2486 € novo human
GWB-573E9B Recombinant Mouse Interleukin-17F bulk Ask price € genways bulk mouse
GWB-4E5CCA Recombinant Human Interleukin-17F bulk Ask price € genways bulk human
GWB-2A1DB4 Recombinant Rat Interleukin-17F bulk Ask price € genways bulk rat
abx574982 Anti-Mouse Interleukin 17F (IL17F) ELISA Kit inquire 50 € abbex mouse
DL-IL17F-Mu Mouse Interleukin 17F IL17F ELISA Kit 96T 788 € DL elisas mouse
MBS222761 Anti-HUMAN INTERLEUKIN-17F 100ug 636 € MBS Polyclonals_1 human
abx574442 Anti-Human Interleukin 17F (IL17F) ELISA Kit 96 tests 688 € abbex human
AR51039PU-N anti-Interleukin-17F / IL17F (31-163, His-tag) Antibody 0,5 mg 1109 € acr human
AR51039PU-S anti-Interleukin-17F / IL17F (31-163, His-tag) Antibody 0,1 mg 485 € acr human
AM31270AF-N anti-Interleukin-17F / IL17F Antibody 0,5 mg 717 € acr human
AM31324AF-N anti-Interleukin-17F / IL17F Antibody 1 mg 1196 € acr human
AM31346BT-N anti-Interleukin-17F / IL17F Antibody 0,1 mg 717 € acr human
AM33382AF-N anti-Interleukin-17F / IL17F Antibody 0,5 mg 717 € acr human
AM33382PU-N anti-Interleukin-17F / IL17F Antibody 2 ml/200Tests 413 € acr human
AR31085PU-N anti-Interleukin-17F / IL17F Antibody 20 Вµg 384 € acr human
AR31085PU-S anti-Interleukin-17F / IL17F Antibody 5 Вµg 253 € acr human
GENTAUR-58bdc498b3e90 Anti- Interleukin 17F (IL17F) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc499149ea Anti- Interleukin 17F (IL17F) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc65b44a41 Anti- Interleukin 17F (IL17F) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd9916183b Anti- Interleukin 17F (IL17F) Antibody 100ug 542 € MBS Polyclonals human
PA241 anti-Interleukin-17F / IL17F Antibody 5 Вµg 253 € acr human
PA241X anti-Interleukin-17F / IL17F Antibody 25 Вµg 384 € acr human