| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human SLAMF2 is produced by our Mammalian expression system and the target gene encoding Gln27-Ser220 is expressed with a Fc |
| Molecular Weight: |
1 kD, 53 |
| UniProt number: |
P09326 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD48 (C-Fc-6His), SLAM Family Member 2 |
| Short name: |
CD48 (C-Fc-6His), Recombinant SLAM Family Member 2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD48 molecule (C-fragment c-6His), sapiens SLAM family Member 2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BCM1 and BLAST and BLAST1 and hCD48 and mCD48 and MEM-102 and SLAMF2, CD48 and IDBG-104080 and ENSG00000117091 and 962, CD48 and IDBG-630526 and ENSBTAG00000011238 and 508386, Cd48 and IDBG-204791 and ENSMUSG00000015355 and 12506, Cell surfaces, protein binding, this GO :0003823 and antigen binding and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006952 and defense response and biological process this GO :0007165 and signal transduction and biological process this GO :0007596 and blood coagulation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0042110 and T cell activation and biological process this GO :0043234 and protein complex and cellular component this GO :0045121 and membrane raft and cellular component this GO :0045576 and mast cell activation and biological process this GO :0046658 and anchored component of plasma membrane and cellular component this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003823 : antigen binding, this GO :0003823 : antigen binding and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, CD48 molecule |
| Identity: |
1683 |
| Gene: |
CD48 |
More about : CD48 |
| Long gene name: |
CD48 molecule |
| Synonyms gene: |
BCM1 |
| Synonyms gene name: |
CD48 antigen (B-cell membrane protein) CD48 molecule |
| Synonyms: |
BLAST mCD48 hCD48 SLAMF2 |
| Locus: |
1q23, 3 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
BC016182 |
| Entrez gene record: |
962 |
| Pubmed identfication: |
2828034 |
| RefSeq identity: |
NM_001778 |
| Classification: |
Immunoglobulin like domain containing CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000024009 |