| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human Fc gamma RIIIB is produced by our Mammalian expression system and the target gene encoding Thr20-Gln208 is expressed with a Fc |
| Molecular Weight: |
4 kD, 51 |
| UniProt number: |
O75015 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD16b (C-Fc-6His), FCGR3B, RIIIB, Fc &gamma |
| Short name: |
CD16b (C-Fc-6His), FCGR3B, RIIIB, Recombinant Fc &gamma |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
CD16b (C-fragment c-6His), RIIIB, fragment c fragment on Immunoglobulin G, low affinity IIIb, receptor (CD16b), sapiens fragment c &gamma, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD16 and CD16b and FCG3 and FCGR3 and FCR-10 and FCRIII and FCRIIIb, FCGR3B and IDBG-104303 and ENSG00000162747 and 2215, IgG binding, Plasma membranes, low affinity IIIb, receptor (CD16b), this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0019864 and IgG binding and molecular function this GO :0031225 and anchored component of membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0019864 : IgG binding, this GO :0019864 : IgG binding, Fc fragment of IgG |
| Identity: |
3620 |
| Gene: |
FCGR3B |
More about : FCGR3B |
| Long gene name: |
Fc fragment of IgG receptor IIIb |
| Synonyms gene: |
FCGR3 FCG3 |
| Synonyms gene name: |
Fc fragment of IgG, low affinity IIIb, low affinity IIIb, receptor (CD16b) , receptor for (CD16) Fc fragment of IgG |
| Synonyms: |
CD16 CD16b |
| Synonyms name: |
Fc gamma receptor IIIb |
| Locus: |
1q23, 3 |
| Discovery year: |
1991-08-21 |
| GenBank acession: |
J04162 |
| Entrez gene record: |
2215 |
| Pubmed identfication: |
2139735 |
| RefSeq identity: |
NM_000570 |
| Classification: |
CD molecules Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000074099 |