Recombinant Human Trypsin 1, TRP1, TRY1, TRYP1, PRSS1 (C-Fc-6His)

Contact us
Catalog number: CB81
Price: 2486 €
Supplier: novo
Product name: Recombinant Human Trypsin 1, TRP1, TRY1, TRYP1, PRSS1 (C-Fc-6His)
Quantity: 1 mg
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human Trypsin 1 is produced by our Mammalian expression system and the target gene encoding Ala16-Ser247 is expressed with a Fc
Molecular Weight: 52, 9 kD
UniProt number: P07477
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: APFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PRSS1 (C-Fc-6His), TRP1, TRY1, TRYP1, Trypsin 1
Short name: PRSS1 (C-Fc-6His), TRP1, TRY1, TRYP1, Recombinant Trypsin 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PRSS1 (C-fragment c-6His), TRP1, TRY1, TRYP1, sapiens Trypsin 1, recombinant H
Alternative technique: rec
Identity: 9475
Gene: PRSS1 | More about : PRSS1
Long gene name: protease, serine 1
Synonyms gene: TRY1
Synonyms gene name: trypsin 1
Locus: 7q34
Discovery year: 2001-06-22
GenBank acession: M22612
Entrez gene record: 5644
Classification: Proteases, serine
Havana BLAST/BLAT: OTTHUMG00000158923
Locus Specific Databases: LRG_1013

Related Products :

CB81 Recombinant Human Trypsin 1, TRP1, TRY1, TRYP1, PRSS1 (C-Fc-6His) 10 µg 202 € novo human
GENTAUR-58b8fa01c2fb3 Anopheles gambiae Trypsin-1 (TRYP1) 100ug 1685 € MBS Recombinant Proteins human
GENTAUR-58b8fa02284d3 Anopheles gambiae Trypsin-1 (TRYP1) 1000ug 1685 € MBS Recombinant Proteins human
GENTAUR-58b8fa029aa8b Anopheles gambiae Trypsin-1 (TRYP1) 100ug 2199 € MBS Recombinant Proteins human
GENTAUR-58b8fa02ef305 Anopheles gambiae Trypsin-1 (TRYP1) 1000ug 2199 € MBS Recombinant Proteins human
GENTAUR-58b9f829d82e1 Anopheles gambiae Trypsin-1 (TRYP1) 100ug 1685 € MBS Recombinant Proteins human
GENTAUR-58b9f82a528f0 Anopheles gambiae Trypsin-1 (TRYP1) 1000ug 1685 € MBS Recombinant Proteins human
GENTAUR-58b9f82aa1c77 Anopheles gambiae Trypsin-1 (TRYP1) 100ug 2199 € MBS Recombinant Proteins human
GENTAUR-58b9f82b2bf19 Anopheles gambiae Trypsin-1 (TRYP1) 1000ug 2199 € MBS Recombinant Proteins human
AM05143PU-N anti-Trypsin-1 / PRSS1 Antibody 0,2 mg 630 € acr human
AM05145PU-N anti-Trypsin-1 / PRSS1 Antibody 0,2 mg 630 € acr human
AP00906PU-N anti-Trypsin-1 / PRSS1 Antibody 1 ml 659 € acr human
AP21396AF-N anti-Trypsin-1 / PRSS1 Antibody 10 mg 398 € acr human
AP21396BT-N anti-Trypsin-1 / PRSS1 Antibody 1 ml 558 € acr human
AP21396PU-N anti-Trypsin-1 / PRSS1 Antibody 1 mg 688 € acr human
BA630 anti-Trypsin-1 / PRSS1 Antibody 0,1 mg 674 € acr human
BM2175 anti-Trypsin-1 / PRSS1 Antibody 0,2 mg 645 € acr human
CPA1955-100ul anti-Trypsin-1 / PRSS1 Antibody 0,1 ml 442 € acr human
CPA1955-200ul anti-Trypsin-1 / PRSS1 Antibody 0,2 ml 688 € acr human
CPA1955-30ul anti-Trypsin-1 / PRSS1 Antibody 30 Вµl 326 € acr human
R1113 anti-Trypsin-1 / PRSS1 Antibody 2 ml 1761 € acr human
R1113HRPS anti-Trypsin-1 / PRSS1 Antibody 0,1 mg 703 € acr human
DB 023-0.05 anti-Trypsin-1 / PRSS1 (C-term) Antibody 50 Вµl 587 € acr human
DB 023-0.1 anti-Trypsin-1 / PRSS1 (C-term) Antibody 0,1 ml 848 € acr human
AP53464PU-N anti-Trypsin-1 / PRSS1 (Center) Antibody 0,4 ml 587 € acr human
DB 022-0.05 anti-Trypsin-1 / PRSS1 (N-term) Antibody 50 Вµl 500 € acr human
DB 022-0.1 anti-Trypsin-1 / PRSS1 (N-term) Antibody 0,1 ml 717 € acr human
RP-1577H Recombinant Human TRP1 / TYRP1 Protein (His Tag) 20μg 572 € adv human
C821 Recombinant Human Airway Trypsin-Like Protease 5, HATL5, TMPRSS11B (C-6His) 1 mg 2283 € novo human
CI25 Recombinant Human Inter-α-Trypsin Inhibitor Heavy Chain H3, ITIH3 (C-6His) 1 mg 2486 € novo human