Recombinant Human E-Selectin, , ELAM1, CD62E (C-6His)

Contact us
Catalog number: CB50
Price: 654 €
Supplier: genways
Product name: Recombinant Human E-Selectin, , ELAM1, CD62E (C-6His)
Quantity: 1 x 1 vial
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 232€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human E-selectin is produced by our Mammalian expression system and the target gene encoding Trp22-Pro556 is expressed with a 6His tag at the C-terminus
Molecular Weight: 58, 6 kD
UniProt number: P16581
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 4% Mannitol, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD62E (C-6His), ELAM1, E-Selectin
Short name: CD62E (C-6His), ELAM1, Recombinant E-Selectin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: , CD62E (C-6His), ELAM1, sapiens E-Selectin, recombinant H
Alternative technique: rec
Identity: 10718
Gene: SELE | More about : SELE
Long gene name: selectin E
Synonyms gene: ELAM1 ELAM
Synonyms gene name: endothelial adhesion molecule 1
Synonyms: ESEL CD62E
Locus: 1q24, 2
Discovery year: 1989-06-30
GenBank acession: M30640
Entrez gene record: 6401
Pubmed identfication: 1375831
RefSeq identity: NM_000450
Classification: Sushi domain containing Selectins CD molecules C-type lectin domain containing
Havana BLAST/BLAT: OTTHUMG00000034851

Related Products :

CB50 Recombinant Human E-Selectin, , ELAM1, CD62E (C-6His) 50 µg 232 € novo human
OBT4471B CD62E, E-Selectin, Clone: CL2/6, Mouse Monoclonal antibody-Human, Dog (L-Selectin only), Biotin; flow vial Ask price € accurate-monoclonals dog
OBT0376F CD62E/CD62P, E- & P-Selectins, ELAM-1, Clone: 1.2B6, Mouse Monoclonal antibody-Human, Swine (CD62E only), FITC; flow/Inhibits Adhesion 0.1 mg Ask price € accurate-monoclonals human
OBT0376 CD62E/CD62P, E- & P-Selectins, ELAM-1, Clone: 1.2B6, Mouse Monoclonal antibody-Human, Swine (CD62E only); frozen/NO paraffin, IH/flow/ELISA/WB (non-reduc ONLY) 200ug Ask price € accurate-monoclonals human
RP-0662H Recombinant Human E-Selectin / CD62e / SELE Protein (His & Fc Tag) 100μg 659 € adv human
RP-0661H Recombinant Human E-Selectin / CD62e / SELE Protein (His Tag) 100μg 624 € adv human
RP-1151M Recombinant Mouse E-Selectin / CD62e / SELE Protein 100μg 624 € adv mouse
RP-1150M Recombinant Mouse E-Selectin / CD62e / SELE Protein (Fc Tag) 100μg 624 € adv mouse
RP-2129R Recombinant Rat E-Selectin / CD62e / SELE Protein (Fc Tag) 100μg 624 € adv rat
RP-2130R Recombinant Rat E-Selectin / CD62e / SELE Protein (His Tag) 100μg 624 € adv rat
MBS241978 Anti-Human SELE / CD62E / E-selectin Antibody 50ug 597 € MBS Polyclonals_1 human
BYA9615-1 CD62E, E-Selectin, Clone: 1.2B6, Mouse Monoclonal antibody-Human 0.2 ml 688 € accurate-monoclonals human
BYA9664-1 CD62E, E-Selectin, Clone: 1.2B6, Mouse Monoclonal antibody-Human vial 597 € accurate-monoclonals human
MEDCLA797-01 CD62E, E-Selectin, Clone: 16G4, Mouse Monoclonal antibody-Human; paraffin/NO frozen, IH/No WB 0.1000ul 223 € accurate-monoclonals human
MEDCLA797-1 CD62E, E-Selectin, Clone: 16G4, Mouse Monoclonal antibody-Human; paraffin/NO frozen, IH/No WB 1000ul 1034 € accurate-monoclonals human
OBT3086 CD62E, E-Selectin, ELAM-1, Clone: 1.2B6, Mouse Monoclonal antibody-Human 200ug Ask price € accurate-monoclonals human
OBT3086G CD62E, E-Selectin, ELAM-1, Clone: 1.2B6, Mouse Monoclonal antibody-Human 0.1 mg Ask price € accurate-monoclonals human
OBT3086F CD62E, E-Selectin, ELAM-1, Clone: 1.2B6, Mouse Monoclonal antibody-Human, FITC vial Ask price € accurate-monoclonals human
MEDCLA268 CD62E, E-Selectin, ELAM-1, Clone: 1.2B6, Mouse Monoclonal antibody-Human; frozen 1000ul Ask price € accurate-monoclonals human
OBT3086R CD62E, E-Selectin, ELAM-1, Clone: 1.2B6, Mouse Monoclonal antibody-Human, RPE vial Ask price € accurate-monoclonals human
BMA4D10 CD62E, E-Selectin, ELAM 1, Clone: 4D10, Rat Mouse Monoclonal antibody-Human; IH/FACS 0.5mg 1245 € accurate-monoclonals human
YM6010 CD62E, E-Selectin, ELAM-1, Clone: ENA1, Mouse Monoclonal antibody-Human, Chimp, Rhesus, Cynomolgus, Bab 1000ul 775 € accurate-monoclonals rhesus
YM6010B CD62E, E-Selectin, ELAM-1, Clone: ENA1, Mouse Monoclonal antibody-Human, Chimp, Rhesus, Cynomolgus, Bab, Biotin 1000ul 1065 € accurate-monoclonals rhesus
YM6011 CD62E, E-Selectin, ELAM-1, Clone: ENA2, Mouse Monoclonal antibody-Human, Chimp, Rhesus, Cynomolgus, Bab 1000ul 1272 € accurate-monoclonals rhesus
GWB-407FB2 CD62E/E-selectin Human -FITC conjugated, antibody 1 x 1 vial 845 € genways human
GWB-51C0A0 CD62E/E-selectin Human -PE, antibody 1 x 1 vial 1030 € genways human
BMDV3218 E-Selectin, CD62E, ELAM-1, 155kD, Clone: 1.2B6, Mouse Monoclonal antibody-Human; frozen/NO paraffin 500ul 448 € accurate-monoclonals human
AXL7228M ELAM 1, CD62E, E-Selectin, Clone: 1.2B6, Mouse Monoclonal antibody-Human 1000ul 1899 € accurate-monoclonals human
GWB-2855FF Mouse antibody to or anti-Human CD62E (E-selectin), antibody 1 x 1 vial 631 € genways human
GWB-2C4FAC Mouse antibody to or anti-Human CD62E (E-selectin), antibody 1 x 1 vial 654 € genways human