Recombinant Human Low-Density Lipoprotein Receptor, LDLR (C-6His)

Contact us
Catalog number: CA88
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Low-Density Lipoprotein Receptor, LDLR (C-6His)
Quantity: inquire
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 359€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LDL Receptor is produced by our Mammalian expression system and the target gene encoding Ala22-Arg788 is expressed with a 6His tag at the C-terminus
Molecular Weight: 78 kD, 84
UniProt number: P01130
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 50 mM HEPES, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVRLENLYFQGHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: LDLR (C-6His), Lipoprotein Receptor
Short name: LDLR (C-6His), Recombinant Low-Density Lipoprotein Receptor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: low density lipoprotein receptor (C-6His), sapiens Low-Density Lipoprotein Receptor, recombinant H
Alternative technique: rec
Alternative to gene target: Cell surfaces, FH and FHC and LDLCQ2, LDLR and IDBG-28808 and ENSG00000130164 and 3949, LDLR and IDBG-643476 and ENSBTAG00000012314 and 281276, Ldlr and IDBG-141358 and ENSMUSG00000032193 and 16835, this GO :0001523 and retinoid metabolic process and biological process this GO :0001948 and glycoprotein binding and molecular function this GO :0005041 and low-density lipoprotein receptor activity and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005764 and lysosome and cellular component this GO :0005768 and endosome and cellular component this GO :0005769 and early endosome and cellular component this GO :0005770 and late endosome and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005905 and coated pit and cellular component this GO :0006629 and lipid metabolic process and biological process this GO :0006897 and endocytosis and biological process this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0007603 and phototransduction, this GO :0001948 : glycoprotein binding, this GO :0001948 : glycoprotein binding and also this GO :0005041 : low-density lipoprotein receptor activity and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0030169 : low-density lipoprotein particle binding and also this GO :0030229 : very-low-density lipoprotein particle receptor activity, this GO :0005041 : low-density lipoprotein receptor activity, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0030169 : low-density lipoprotein particle binding, this GO :0030229 : very-low-density lipoprotein particle receptor activity, very-low-density lipoprotein particle receptor activity, visible light and biological process this GO :0008203 and cholesterol metabolic process and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010008 and endosome membrane and cellular component this GO :0010867 and positive regulation of triglyceride biosynthetic process and biological process this GO :0010899 and regulation of phosphatidylcholine catabolic process and biological process this GO :0015914 and phospholipid transport and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0030169 and low-density lipoprotein particle binding and molecular function this GO :0030229 and very-low-density lipoprotein particle receptor activity and molecular function this GO :0030299 and intestinal cholesterol absorption and biological process this GO :0030301 and cholesterol transport and biological process this GO :0030669 and clathrin-coated endocytic vesicle membrane and cellular component this GO :0034362 and low-density lipoprotein particle and cellular component this GO :0034383 and low-density lipoprotein particle clearance and biological process this GO :0042157 and lipoprotein metabolic process and biological process this GO :0042159 and lipoprotein catabolic process and biological process this GO :0042632 and cholesterol homeostasis and biological process this GO :0043235 and receptor complex and cellular component this GO :0044281 and small molecule metabolic process and biological process this GO :0070508 and cholesterol import and biological process this GO :2000188 and regulation of cholesterol homeostasis and biological process, low density lipoprotein receptor
Identity: 6547
Gene: LDLR | More about : LDLR
Long gene name: low density lipoprotein receptor
Synonyms: LDLCQ2
Synonyms name: familial hypercholesterolemia
Locus: 19p13, 2
Discovery year: 1986-01-01
GenBank acession: AY114155
Entrez gene record: 3949
Classification: Low density lipoprotein receptors
Havana BLAST/BLAT: OTTHUMG00000171935
Locus Specific Databases: Familial UMD Locus Specific Databases British Heart Foundation LRG_274 , Hypercholesterolemia

Related Products :

MBS619377 SORL1 (Sortilin-related Receptor L(DLR class) A Repeats Containing, gp250, Low Density Lipoprotein Receptor Relative with 11 Ligand Binding Repeats, LDLR Relative with 11 Ligand Binding Repeats, LR11, LRP9, Mosaic Protein LR11, SorLA-1, Sortilin-related R 100ug 735 € MBS Polyclonals_1 human
CA88 Recombinant Human Low-Density Lipoprotein Receptor, LDLR (C-6His) 50 µg 359 € novo human
CC70 Recombinant Human Low-Density Lipoprotein Receptor, LDLR (C-6His, AVI) 1 mg 2486 € novo human
DL-LDLR-Hu Human Low Density Lipoprotein Receptor LDLR ELISA Kit 96T 869 € DL elisas human
AE35818RB-48 ELISA test for Rabbit Low-density lipoprotein receptor (LDLR) 1x plate of 48 wells 402 € abebio human
GWB-19256D Low Density Lipoprotein Receptor (LDLR), antibody 1 x 1 vial 879 € genways human
EKU05677 Low Density Lipoprotein Receptor (LDLR) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU05678 Low Density Lipoprotein Receptor (LDLR) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
GWB-4CD9A7 Low Density Lipoprotein Receptor (LDLR) Rabbit antibody to or anti-Mouse Polyclonal (aa499-511) antibody 1 x 1 vial 872 € genways mouse
DL-LDLR-Mu Mouse Low Density Lipoprotein Receptor LDLR ELISA Kit 96T 904 € DL elisas mouse
AE35818RB Rabbit Low-density lipoprotein receptor (LDLR) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE35818RB-96 Rabbit Low-density lipoprotein receptor (LDLR) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58b9ee2648f17 Rat Low-density lipoprotein receptor (Ldlr) 100ug 3072 € MBS Recombinant Proteins rat
GENTAUR-58b9ee26c643b Rat Low-density lipoprotein receptor (Ldlr) 1000ug 3072 € MBS Recombinant Proteins rat
GENTAUR-58b9ee2755ac2 Rat Low-density lipoprotein receptor (Ldlr) 100ug 3580 € MBS Recombinant Proteins rat
GENTAUR-58b9ee27e9257 Rat Low-density lipoprotein receptor (Ldlr) 1000ug 3580 € MBS Recombinant Proteins rat
C389 Recombinant Human Low-Density Lipoprotein Receptor Related Protein 12, LRP12 (C-6His) 500 µg 1613 € novo human
C524 Recombinant Human Oxidized Low-Density Lipoprotein Receptor 1, OLR1 (C-6His) 1 mg 2283 € novo human
abx167794 Anti-Lectin Like Oxidized Low Density Lipoprotein Receptor 1 Protein (Recombinant) 10 μg 427 € abbex human
abx168011 Anti-Lectin Like Oxidized Low Density Lipoprotein Receptor 1 Protein (Recombinant) 50 μg 644 € abbex human
abx261903 Anti-Low Density Lipoprotein Receptor Adaptor Protein 1 Protein (Recombinant) 5 µg 238 € abbex human
abx166665 Anti-Low Density Lipoprotein Receptor Protein (Recombinant) 50 μg 601 € abbex human
abx168353 Anti-Low Density Lipoprotein Receptor Protein (Recombinant) 100 μg 847 € abbex human
abx168494 Anti-Low Density Lipoprotein Receptor Protein (Recombinant) 10 μg 412 € abbex human
abx261492 Anti-Oxidized Low Density Lipoprotein Receptor 1 Protein (Recombinant) 1 mg 3559 € abbex human
abx166850 Anti-Very Low Density Lipoprotein Receptor Protein (Recombinant) 50 μg 601 € abbex human
MBS619779 b-Lipoprotein, Low Density (LDL, Beta Lipoprotein) 1 mililiter 387 € MBS Polyclonals_1 human
AQSDEN001 Analyst Qualification Set Density at 20°C Low, Density Range 0.7g/ml to 0.95g/ml 250ml 853 € reageco human
MBS612244 Nerve Growth Factor Receptor, p75 (NGFR, NGF Receptor, CD271, Gp80 LNGFR, Low Affinity Nerve Growth Factor Receptor, Low Affinity Neurotrophin Receptor p75 NTR, p75 ICD, p75 Neurotrophin, p75 NTR, Tumor Necrosis Factor Receptor Superfamily Member 16, TNFR Antibody 100ug 591 € MBS Polyclonals_1 human
abx250152 Anti-Human Lectin Like Oxidized Low Density Lipoprotein Receptor 1 ELISA Kit inquire 50 € abbex human