Recombinant Human Proenkephalin-A (C-6His)

Contact us
Catalog number: CA69
Price: 370 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Proenkephalin-A (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Proenkephalin-A is produced by our Mammalian expression system and the target gene encoding Glu25-Phe267 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 29
UniProt number: P01210
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRFVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: Proenkephalin-A (C-6His)
Short name: Recombinant Proenkephalin-A (C-6His)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Proenkephalin-A (C-6His), recombinant H
Alternative technique: rec

Related Products :

CA69 Recombinant Human Proenkephalin-A (C-6His) 1 mg 2283 € novo human
abx253776 Anti-Human Proenkephalin-A ELISA Kit 96 tests 659 € abbex human
abx250393 Anti-Human Proenkephalin-B ELISA Kit inquire 50 € abbex human
abx152830 Anti-Human Proenkephalin ELISA Kit inquire 50 € abbex human
abx571368 Anti-Human Proenkephalin (PENK) ELISA Kit inquire 50 € abbex human
DL-PENK-Hu Human Proenkephalin PENK ELISA Kit 96T 904 € DL elisas human
MBS248176 PAb (IgG) to Human Proenkephalin / PENK 100ul 597 € MBS Polyclonals_1 human
GENTAUR-58be5d147fd19 Anti-Dynorphin A/Proenkephalin B, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx154579 Anti-Mouse Proenkephalin ELISA Kit inquire 50 € abbex mouse
abx576390 Anti-Mouse Proenkephalin (PENK) ELISA Kit 96 tests 804 € abbex mouse
AP32079PU-N anti-Proenkephalin-A (PENK) Antibody 0,1 mg 558 € acr human
RA14124-50 anti-Proenkephalin-A (PENK) Antibody 50 Вµl 369 € acr human
BP5044 anti-Proenkephalin-A (PENK) (Met-enkephalin) Antibody 50 Вµl 543 € acr human
abx256249 Anti-Rat Proenkephalin-A ELISA Kit inquire 50 € abbex rat
abx256392 Anti-Rat Proenkephalin-B ELISA Kit inquire 50 € abbex rat
bs-13041R-A350 Dynorphin A/Proenkephalin B Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13041R-A488 Dynorphin A/Proenkephalin B Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13041R-A555 Dynorphin A/Proenkephalin B Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13041R-A594 Dynorphin A/Proenkephalin B Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13041R-A647 Dynorphin A/Proenkephalin B Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13041R-Biotin Dynorphin A/Proenkephalin B Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-13041R Dynorphin A/Proenkephalin B Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-13041R-Cy3 Dynorphin A/Proenkephalin B Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13041R-Cy5 Dynorphin A/Proenkephalin B Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13041R-Cy5.5 Dynorphin A/Proenkephalin B Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13041R-Cy7 Dynorphin A/Proenkephalin B Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13041R-FITC Dynorphin A/Proenkephalin B Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-13041R-HRP Dynorphin A/Proenkephalin B Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
AE28095PI-48 ELISA test for Pig Proenkephalin-B (PDYN) 1x plate of 48 wells 402 € abebio pig
MBS420561 Goat anti-Proenkephalin Antibody 100ug 370 € MBS Polyclonals_1 human