Recombinant Human Natural Killer Cells Antigen CD94, CD94 (N-6His)

Contact us
Catalog number: CA63
Price: 608 €
Supplier: MBS mono
Product name: Recombinant Human Natural Killer Cells Antigen CD94, CD94 (N-6His)
Quantity: 100ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Natural Killer Cells Antigen CD94 is produced by our Mammalian expression system and the target gene encoding Ser34-Ile179 is expressed with a 6His tag at the N-terminus
Molecular Weight: 17, 7 kD
UniProt number: Q13241
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HHHHHHSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD94 (N-6His), Natural Killer Cells CD94
Short name: CD94 (N-6His), Recombinant Natural Killer Cells Antigen CD94
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD94 (N-6His), sapiens Natural Killer Cells protein CD94, recombinant H
Alternative technique: rec
Identity: 6378
Gene: KLRD1 | More about : KLRD1
Long gene name: killer cell lectin like receptor D1
Synonyms gene: CD94
Synonyms gene name: killer cell lectin-like receptor subfamily D, member 1
Locus: 12p13
Discovery year: 1998-01-16
GenBank acession: U30610
Entrez gene record: 3824
Pubmed identfication: 7589107
RefSeq identity: NM_002262
Classification: Killer cell lectin like receptors CD molecules C-type lectin domain containing
Havana BLAST/BLAT: OTTHUMG00000168419

Related Products :

CA63 Recombinant Human Natural Killer Cells Antigen CD94, CD94 (N-6His) 500 µg 1613 € novo human
MBS616114 Peroxiredoxin 2 (Peroxiredoxin-2, PRDX2, PRDX-2, PRX2, PRXII, HGNC:9353, MGC4104, Natural Killer Cell Enhancing Factor B, Natural Killer Enhancing Factor B, NKEFB, NKEF-B, PRP, Thiol Specific Antioxidant 1, Thiol-specific Antioxidant Protein, TSA, Thiored 100ug 735 € MBS Polyclonals_1 human
AE36453DO-96 Canine Natural killer cells antigen CD94 (KLRD1) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58bd5ec70c8b6 Dog Natural killer cells antigen CD94 (KLRD1) 100ug 1492 € MBS Recombinant Proteins dog
GENTAUR-58bd5ec75c3f3 Dog Natural killer cells antigen CD94 (KLRD1) 1000ug 1492 € MBS Recombinant Proteins dog
GENTAUR-58bd5ec79edee Dog Natural killer cells antigen CD94 (KLRD1) 100ug 1995 € MBS Recombinant Proteins dog
GENTAUR-58bd5ec7e6800 Dog Natural killer cells antigen CD94 (KLRD1) 1000ug 1995 € MBS Recombinant Proteins dog
AE36453DO-48 ELISA test for Canine Natural killer cells antigen CD94 (KLRD1) 1x plate of 48 wells 402 € abebio human
AE36450MK-48 ELISA test for Monkey Natural killer cells antigen CD94 (KLRD1) 1x plate of 48 wells 402 € abebio monkey
AE36450MK Monkey Natural killer cells antigen CD94 (KLRD1) ELISA Kit 96 wells plate 810 € ab-elisa elisas monkey
AE36450MK-96 Monkey Natural killer cells antigen CD94 (KLRD1) ELISA Kit 1x plate of 96 wells 671 € abebio monkey
CS61 Recombinant Human Natural Killer Cell Receptor 2B4, SLAMF4, CD244 (C-6His) 10 µg 141 € novo human
CS28 Recombinant Mouse SLAMF4, Natural killer cell receptor 2B4, CD244 (C-6His) 1 mg 2283 € novo mouse
GWB-4ED744 Natural Killer Cells protein 4 (IL32) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 x 1 vial 602 € genways human
GWB-EA3030 Natural Killer Cells protein 4 (IL32) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody 1 vial 602 € genways human
abx167358 Anti-Natural Killer Cell Receptor 2B4 Protein (Recombinant) 100 μg 862 € abbex human
MBS619460 SART1 (Squamous Cell Carcinoma Antigen Recognised by T Cells, Squamous Cell Carcinoma Antigen Recognized by T Cells 1, SART-1, ARA1, HOMS1, hSART-1, hSnu66, IgE Autoantigen, MGC2038, SART1-259, SART1259 Protein, SART1 (800) Protein, Snu66, U4/U6.U5 Tri sn Antibody 100ug 735 € MBS Polyclonals_1 human
YSRTMCA1763XZ Mouse NC1.1 Antigen, Natural Cytotoxic Cells, Clone: IC4, Mouse Monoclonal antibody-, azide-free 1 mg 1059 € accurate-monoclonals mouse
YSRTMCA1763F Mouse NC1.1 Antigen, Natural Cytotoxic Cells, Clone: IC4, Mouse Monoclonal antibody-, FITC; flow vial 205 € accurate-monoclonals mouse
YSRTMCA1763FT Mouse NC1.1 Antigen, Natural Cytotoxic Cells, Clone: IC4, Mouse Monoclonal antibody-, FITC; flow 25 ug 149 € accurate-monoclonals mouse
YSRTMCA1763PE Mouse NC1.1 Antigen, Natural Cytotoxic Cells, Clone: IC4, Mouse Monoclonal antibody-, RPE vial 233 € accurate-monoclonals mouse
YSRTMCA1763PET Mouse NC1.1 Antigen, Natural Cytotoxic Cells, Clone: IC4, Mouse Monoclonal antibody-, RPE vial 177 € accurate-monoclonals mouse
OBT4391F NC1.1 Antigen, Natural Cytotoxic Cells, Clone: IC4, Mouse Monoclonal antibody-Mouse, FITC; flow vial Ask price € accurate-monoclonals mouse
OBT4391R NC1.1 Antigen, Natural Cytotoxic Cells, Clone: IC4, Mouse Monoclonal antibody-Mouse, RPE vial Ask price € accurate-monoclonals mouse
abx257238 Anti-Human Natural Killer Cell ELISA Kit inquire 50 € abbex human
GENTAUR-58bdc07d57870 Mouse Anti-Human Natural killer cell p30-related protein Antibody 0.005 miligrams 205 € MBS mono human
GENTAUR-58bdc07dae095 Mouse Anti-Human Natural killer cell p30-related protein Antibody 100ug 608 € MBS mono human
GENTAUR-58bdc07e2a1db Mouse Anti-Human Natural killer cell p44-related protein Antibody 0.005 miligrams 205 € MBS mono human
GENTAUR-58bdc07e80690 Mouse Anti-Human Natural killer cell p44-related protein Antibody 0.02 miligrams 277 € MBS mono human
GENTAUR-58bdc07ee716f Mouse Anti-Human Natural killer cell p44-related protein Antibody 100ug 608 € MBS mono human