Recombinant Human Transforming Growth Factor β-1, TGFB1

Contact us
Catalog number: CA59
Price: 553 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Transforming Growth Factor β-1, TGFB1
Quantity: 100ug
Other quantities: 1 mg 2283€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed
Molecular Weight: 12, 8 kD
UniProt number: P01137
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 50 mM C2H5NO2 50 mM sodium chloride pH4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TGFB1, -1, Transforming Growth Factor &beta
Short name: TGFB1, -1, Recombinant Transforming Growth Factor &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: b 1, sapiens Transforming Growth Factor &beta, transforming growth factor, -1, recombinant H
Alternative technique: rec
Alternative to gene target: CED and DPD1 and LAP and TGFB and TGFbeta, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045930 and negative regulation of mitotic cell cycle and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046732 and active induction of host immune response by virus and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0047485 and protein N-terminus binding and molecular function this GO :0048298 and positive regulation of isotype switching to IgA isotypes and biological process this GO :0048535 and lymph node development and biological process this GO :0048565 and digestive tract development and biological process this GO :0048642 and negative regulation of skeletal muscle tissue development and biological process this GO :0048839 and inner ear development and biological process this GO :0050679 and positive regulation of epithelial cell proliferation and biological process this GO :0050680 and negative regulation of epithelial cell proliferation and biological process this GO :0050714 and positive regulation of protein secretion and biological process this GO :0050765 and negative regulation of pha this GO cytosis and biological process this GO :0050777 and negative regulation of immune response and biological process this GO :0050868 and negative regulation of T cell activation and biological process this GO :0050921 and positive regulation of chemotaxis and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051098 and regulation of binding and biological process this GO :0051101 and regulation of DNA binding and biological process this GO :0051152 and positive regulation of smooth muscle cell differentiation and biological process this GO :0051280 and negative regulation of release of sequestered calcium ion into cytosol and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0060312 and regulation of blood vessel remodeling and biological process this GO :0060325 and face morphogenesis and biological process this GO :0060364 and frontal suture morphogenesis and biological process this GO :0060389 and pathway-restricted SMAD protein phosphorylation and biological process this GO :0060391 and positive regulation of SMAD protein import into nucleus and biological process this GO :0060744 and mammary gland branching involved in thelarche and biological process this GO :0060751 and branch elongation involved in mammary gland duct branching and biological process this GO :0060762 and regulation of branching involved in mammary gland duct morphogenesis and biological process this GO :0061035 and regulation of cartilage development and biological process this GO :0070306 and lens fiber cell differentiation and biological process this GO :0070723 and response to cholesterol and biological process this GO :0071158 and positive regulation of cell cycle arrest and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071549 and cellular response to dexamethasone stimulus and biological process this GO :0071560 and cellular response to transforming growth factor beta stimulus and biological process this GO :0072562 and blood microparticle and cellular component this GO :0085029 and extracellular matrix assembly and biological process this GO :0090190 and positive regulation of branching involved in ureteric bud morphogenesis and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :1900126 and negative regulation of hyaluronan biosynthetic process and biological process this GO :1900182 and positive regulation of protein localization to nucleus and biological process this GO :1901203 and positive regulation of extracellular matrix assembly and biological process this GO :1901666 and positive regulation of NAD+ ADP-ribosyltransferase activity and biological process this GO :2000249 and regulation of actin cytoskeleton reorganization and biological process this GO :2000628 and regulation of miRNA metabolic process and biological process this GO :2000679 and positive regulation of transcription regulatory region DNA binding and biological process, TGFB1 and IDBG-52846 and ENSG00000105329 and 7040, TGFB1 and IDBG-638417 and ENSBTAG00000020457 and 282089, Tgfb1 and IDBG-158292 and ENSMUSG00000002603 and 21803, beta 1, incompatible interaction and biological process this GO :0009986 and cell surface and cellular component this GO :0010033 and response to organic substance and biological process this GO :0010575 and positive regulation vascular endothelial growth factor production and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010716 and negative regulation of extracellular matrix disassembly and biological process this GO :0010718 and positive regulation of epithelial to mesenchymal transition and biological process this GO :0010742 and macrophage derived foam cell differentiation and biological process this GO :0010763 and positive regulation of fibroblast migration and biological process this GO :0010800 and positive regulation of peptidyl-threonine phosphorylation and biological process this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0010936 and negative regulation of macrophage cytokine production and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016049 and cell growth and biological process this GO :0016202 and regulation of striated muscle tissue development and biological process this GO :0017015 and regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0019048 and modulation by virus of host morphology or physiology and biological process this GO :0019049 and evasion or tolerance of host defenses by virus and biological process this GO :0019058 and viral life cycle and biological process this GO :0019899 and enzyme binding and molecular function this GO :0022408 and negative regulation of cell-cell adhesion and biological process this GO :0030141 and secretory granule and cellular component this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030214 and hyaluronan catabolic process and biological process this GO :0030217 and T cell differentiation and biological process this GO :0030279 and negative regulation of ossification and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030424 and axon and cellular component this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0030512 and negative regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0030879 and mammary gland development and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0031065 and positive regulation of histone deacetylation and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0031100 and organ regeneration and biological process this GO :0031334 and positive regulation of protein complex assembly and biological process this GO :0031536 and positive regulation of exit from mitosis and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0032270 and positive regulation of cellular protein metabolic process and biological process this GO :0032355 and response to estradiol and biological process this GO :0032570 and response to progesterone and biological process this GO :0032740 and positive regulation of interleukin-17 production and biological process this GO :0032801 and receptor catabolic process and biological process this GO :0032930 and positive regulation of superoxide anion generation and biological process this GO :0032943 and mononuclear cell proliferation and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033280 and response to vitamin D and biological process this GO :0034616 and response to laminar fluid shear stress and biological process this GO :0035066 and positive regulation of histone acetylation and biological process this GO :0035307 and positive regulation of protein dephosphorylation and biological process this GO :0040007 and growth and biological process this GO :0042060 and wound healing and biological process this GO :0042110 and T cell activation and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0042306 and regulation of protein import into nucleus and biological process this GO :0042307 and positive regulation of protein import into nucleus and biological process this GO :0042482 and positive regulation of odontogenesis and biological process this GO :0042493 and response to drug and biological process this GO :0042552 and myelination and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043011 and myeloid dendritic cell differentiation and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043029 and T cell homeostasis and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0043491 and protein kinase B signaling and biological process this GO :0043536 and positive regulation of blood vessel endothelial cell migration and biological process this GO :0043537 and negative regulation of blood vessel endothelial cell migration and biological process this GO :0043552 and positive regulation of phosphatidylinositol 3-kinase activity and biological process this GO :0043932 and ossification involved in bone remodeling and biological process this GO :0045066 and regulatory T cell differentiation and biological process this GO :0045087 and innate immune response and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0045599 and negative regulation of fat cell differentiation and biological process this GO :0045662 and negative regulation of myoblast differentiation and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0045892 and negative regulation of transcription, nuclei, protein N-terminus binding, this GO :0000060 and protein import into nucleus, this GO :0001948 : glycoprotein binding, this GO :0001948 : glycoprotein binding and also this GO :0003823 : antigen binding and also this GO :0005114 : type II transforming growth factor beta receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0019899 : enzyme binding and also this GO :0042803 : protein homodimerization activity and also this GO :0046982 : protein heterodimerization activity and also this GO :0047485 : protein N-terminus binding, this GO :0003823 : antigen binding, this GO :0005114 : type II transforming growth factor beta receptor binding, this GO :0005125 : cytokine activity, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0019899 : enzyme binding, this GO :0042803 : protein homodimerization activity, this GO :0046982 : protein heterodimerization activity, this GO :0047485 : protein N-terminus binding, translocation and biological process this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000165 and MAPK cascade and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001763 and morphogenesis of a branching structure and biological process this GO :0001775 and cell activation and biological process this GO :0001837 and epithelial to mesenchymal transition and biological process this GO :0001933 and negative regulation of protein phosphorylation and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0001948 and glycoprotein binding and molecular function this GO :0002028 and regulation of sodium ion transport and biological process this GO :0002062 and chondrocyte differentiation and biological process this GO :0002244 and hematopoietic progenitor cell differentiation and biological process this GO :0002248 and connective tissue replacement involved in inflammatory response wound healing and biological process this GO :0002460 and adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains and biological process this GO :0002513 and tolerance induction to self antigen and biological process this GO :0002576 and platelet degranulation and biological process this GO :0003823 and antigen binding and molecular function this GO :0005114 and type II transforming growth factor beta receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005796 and this GO lgi lumen and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005902 and microvillus and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006611 and protein export from nucleus and biological process this GO :0006754 and ATP biosynthetic process and biological process this GO :0006796 and phosphate-containing compound metabolic process and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006954 and inflammatory response and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007093 and mitotic cell cycle checkpoint and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007182 and common-partner SMAD protein phosphorylation and biological process this GO :0007183 and SMAD protein complex assembly and biological process this GO :0007184 and SMAD protein import into nucleus and biological process this GO :0007406 and negative regulation of neuroblast proliferation and biological process this GO :0007435 and salivary gland morphogenesis and biological process this GO :0007492 and endoderm development and biological process this GO :0007565 and female pregnancy and biological process this GO :0007568 and aging and biological process this GO :0007596 and blood coagulation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008156 and negative regulation of DNA replication and biological process this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008354 and germ cell migration and biological process this GO :0009314 and response to radiation and biological process this GO :0009611 and response to wounding and biological process this GO :0009749 and response to glucose and biological process this GO :0009817 and defense response to fungus, transforming growth factor
Identity: 11766
Gene: TGFB1 | More about : TGFB1
Long gene name: transforming growth factor beta 1
Synonyms gene: TGFB DPD1
Synonyms gene name: beta 1 , transforming growth factor
Synonyms: CED TGFbeta
Synonyms name: Camurati-Engelmann disease prepro-transforming growth factor beta-1
Locus: 19q13, 1
Discovery year: 2001-06-22
GenBank acession: X02812
Entrez gene record: 7040
Pubmed identfication: 10631145 10843814
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000182760

Related Products :

MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
MBS616431 Transforming Growth Factor beta1, mature (TGF beta 1, TGFb1, Camurati Engelmann Disease, CED, Diaphyseal Dysplasia 1 Progressive, DPD1, TGFb1, Differentiation inhibiting factor, Cartilage-inducing factor) 0.25 miligrams 542 € MBS Polyclonals_1 human
MBS617766 Transforming Growth Factor beta1 (TGF beta 1, TGFb1, Camurati Engelmann Disease, CED, Diaphyseal Dysplasia 1 Progressive, DPD1, TGFb1, Differentiation inhibiting factor, Cartilage-inducing factor) Antibody 100ug 752 € MBS Polyclonals_1 human
MBS621744 Transforming Growth Factor beta3 (Transforming Growth Factor beta 3, TGF beta 3, TGF beta3, TGFb3, ARVD, FLJ16571) Antibody 500ul 713 € MBS Polyclonals_1 human
CA59 Recombinant Human Transforming Growth Factor β-1, TGFB1 500 µg 1613 € novo human
CA72 Recombinant Human Transforming Growth Factor β-1, TGFB1 (N-8His) 500 µg 1328 € novo human
MBS618947 Transforming Growth Factor beta2 Receptor (16CT) (TGFb2R, TGFBR2, Transforming growth factor, beta receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) 200ug 658 € MBS Polyclonals_1 human
MBS612691 Transforming Growth Factor beta2 Receptor (28NT) (TGFb2R, TGFBR2, Transforming Growth Factor beta Receptor II, AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TbetaR-II, TGFbeta-RII) Antibody 200ug 608 € MBS Polyclonals_1 human
CK33 Recombinant Mouse Transforming Growth Factor β-1, TGFβ1, TGFB1 1 mg 3602 € novo human
DL-TGFb1-Hu Human Transforming Growth Factor Beta 1 TGFb1 ELISA Kit 96T 568 € DL elisas human
GENTAUR-58bdc20a501b0 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdc3f90309f Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 382 € MBS Polyclonals human
GENTAUR-58bdc4572c678 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc73b1615a Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc73b8d56d Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc78b050f5 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc88baebc3 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc88c106e7 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc9fa51272 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 365 € MBS Polyclonals human
GENTAUR-58bdc9fa98d03 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 50ug 299 € MBS Polyclonals human
GENTAUR-58bdca30c76b5 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 376 € MBS Polyclonals human
GENTAUR-58bdcbbec38b0 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdcfcbc913e Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 50ug 293 € MBS Polyclonals human
GENTAUR-58bdcfcc26b9d Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 359 € MBS Polyclonals human
GENTAUR-58bdd00e289b6 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd00e9534f Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdd10e29bd2 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd10e8ece5 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd4326e3c0 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd66f2f582 Anti- Transforming Growth Factor Beta 1 (TGFb1) Antibody 100ug 553 € MBS Polyclonals human