Recombinant Human Reticulocalbin-3, RCN3 (C-6His)

Contact us
Catalog number: CA44
Price: 485 €
Supplier: acr
Product name: Recombinant Human Reticulocalbin-3, RCN3 (C-6His)
Quantity: 50 Вµg
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Reticulocalbin-3 is produced by our Mammalian expression system and the target gene encoding Lys21-Leu328 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 36
UniProt number: Q96D15
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 1 mM DTT, 10%Glycerol, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDELVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: RCN3 (C-6His), Reticulocalbin-3
Short name: RCN3 (C-6His), Recombinant Reticulocalbin-3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: RCN3 (C-6His), sapiens Reticulocalbin-3, recombinant H
Alternative technique: rec
Identity: 21145
Gene: RCN3 | More about : RCN3
Long gene name: reticulocalbin 3
Synonyms gene name: EF-hand calcium binding domain , reticulocalbin 3
Synonyms: RLP49
Locus: 19q13, 33
Discovery year: 2003-05-20
GenBank acession: AY195859
Entrez gene record: 57333
RefSeq identity: NM_020650
Classification: EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000183154

Related Products :

MBS618327 RCN1 (Reticulocalbin 1, Reticulocalbin 1 EF Hand Calcium Binding Domain, Reticulocalbin-1, RCAL, RCN, FLJ37041, Proliferation Inducing Gene 20, PIG20) Antibody 100ul 785 € MBS Polyclonals_1 human
CA44 Recombinant Human Reticulocalbin-3, RCN3 (C-6His) 1 mg 2283 € novo human
AR50259PU-N anti-Reticulocalbin-3 / RCN3 (21-328, His-tag) Antibody 0,5 mg 1109 € acr human
AR50259PU-S anti-Reticulocalbin-3 / RCN3 (21-328, His-tag) Antibody 0,1 mg 485 € acr human
GENTAUR-58bdad6a8be69 Bovine Reticulocalbin-3 (RCN3) 100ug 1890 € MBS Recombinant Proteins bovine
GENTAUR-58bdad6ae326b Bovine Reticulocalbin-3 (RCN3) 1000ug 1890 € MBS Recombinant Proteins bovine
GENTAUR-58bdad6b58a08 Bovine Reticulocalbin-3 (RCN3) 100ug 2404 € MBS Recombinant Proteins bovine
GENTAUR-58bdad6bc3cb6 Bovine Reticulocalbin-3 (RCN3) 1000ug 2404 € MBS Recombinant Proteins bovine
RP-1302H Recombinant Human RCN3 Protein (His Tag) 20μg 456 € adv human
RP-1470M Recombinant Mouse RCN3 Protein (His Tag) 20μg 572 € adv mouse
GWB-P0604F RCN3, 21-328aa , Human, His tag, E.coli bulk Ask price € genways bulk human
LV285051 RCN3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
abx931170 Anti-RCN3 siRNA 30 nmol 717 € abbex human
abx931171 Anti-RCN3 siRNA 30 nmol 717 € abbex human
GWB-D00B19 RCN3 Over-expression Lysate reagent 1 vial 463 € genways human
abx262856 Anti-Reticulocalbin 1 Protein (Recombinant) 2 µg 238 € abbex human
abx262751 Anti-Reticulocalbin 2 Protein (Recombinant) 10 µg 340 € abbex human
abx260866 Anti-Reticulocalbin 3 Protein (Recombinant) 5 µg 238 € abbex human
abx253097 Anti-Human Reticulocalbin 1 ELISA Kit inquire 50 € abbex human
abx152954 Anti-Human Reticulocalbin 2 ELISA Kit inquire 50 € abbex human
abx572831 Anti-Human Reticulocalbin 2 (RCN2) ELISA Kit inquire 50 € abbex human
GENTAUR-58bd580e4195e Human Reticulocalbin-1 (RCN1) 100ug 1879 € MBS Recombinant Proteins human
GENTAUR-58bd580e9797e Human Reticulocalbin-1 (RCN1) 1000ug 1879 € MBS Recombinant Proteins human
GENTAUR-58bd580ed3f4a Human Reticulocalbin-1 (RCN1) 100ug 2387 € MBS Recombinant Proteins human
GENTAUR-58bd580f2be87 Human Reticulocalbin-1 (RCN1) 1000ug 2387 € MBS Recombinant Proteins human
DL-RCN2-Hu Human Reticulocalbin 2 RCN2 ELISA Kit 96T 904 € DL elisas human
abx154617 Anti-Mouse Reticulocalbin 2 ELISA Kit inquire 50 € abbex mouse
abx571212 Anti-Mouse Reticulocalbin 2 (RCN2) ELISA Kit 96 tests 804 € abbex mouse
AR09610PU-L anti-Reticulocalbin-1 / RCN1 (30-331, His-tag) Antibody 0,25 mg 1138 € acr human
AR09610PU-N anti-Reticulocalbin-1 / RCN1 (30-331, His-tag) Antibody 50 Вµg 485 € acr human