Recombinant Human Chymotrypsin-Like Elastase Family Member 3A, CELA3A (C-6His)

Contact us
Catalog number: CA31
Price: 1719 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Chymotrypsin-Like Elastase Family Member 3A, CELA3A (C-6His)
Quantity: 100ug
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CELA3A is produced by our Mammalian expression system and the target gene encoding Ser16-His270 is expressed with a 6His tag at the C-terminus
Molecular Weight: 28, 9 kD
UniProt number: P09093
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10%Glycerol, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASHVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CELA3A (C-6His), Chymotrypsin-Like Elastase Family Member 3A
Short name: CELA3A (C-6His), Recombinant Chymotrypsin-Like Elastase Family Member 3A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CELA3A (C-6His), sapiens Chymotrypsin-Like Elastase family Member 3A, recombinant H
Alternative technique: rec
Identity: 15944
Gene: CELA3A | More about : CELA3A
Long gene name: chymotrypsin like elastase family member 3A
Synonyms gene: ELA3A
Synonyms gene name: elastase 3A, member 3A , pancreatic (protease E) elastase 3A, pancreatic chymotrypsin-like elastase family
Synonyms: ELA3
Synonyms name: protease E
Locus: 1p36, 12
Discovery year: 2001-07-18
GenBank acession: D00306
Entrez gene record: 10136
Pubmed identfication: 2826474 2460440
RefSeq identity: NM_005747
Havana BLAST/BLAT: OTTHUMG00000002755

Related Products :

CA31 Recombinant Human Chymotrypsin-Like Elastase Family Member 3A, CELA3A (C-6His) 500 µg 1613 € novo human
abx250950 Anti-Human Chymotrypsin-like elastase family member 1 ELISA Kit inquire 50 € abbex human
GENTAUR-58b8fdf140054 Human Chymotrypsin-like elastase family member 2A (CELA2A) 100ug 1719 € MBS Recombinant Proteins human
GENTAUR-58b8fdf1a88d2 Human Chymotrypsin-like elastase family member 2A (CELA2A) 1000ug 1719 € MBS Recombinant Proteins human
GENTAUR-58b8fdf2141a0 Human Chymotrypsin-like elastase family member 2A (CELA2A) 100ug 2232 € MBS Recombinant Proteins human
GENTAUR-58b8fdf27b906 Human Chymotrypsin-like elastase family member 2A (CELA2A) 1000ug 2232 € MBS Recombinant Proteins human
GENTAUR-58b9fec6c00b8 Human Chymotrypsin-like elastase family member 2A (CELA2A) 100ug 1719 € MBS Recombinant Proteins human
GENTAUR-58b9fec79a033 Human Chymotrypsin-like elastase family member 2A (CELA2A) 1000ug 1719 € MBS Recombinant Proteins human
GENTAUR-58b9fec80d8fd Human Chymotrypsin-like elastase family member 2A (CELA2A) 100ug 2232 € MBS Recombinant Proteins human
GENTAUR-58b9fec8b0161 Human Chymotrypsin-like elastase family member 2A (CELA2A) 1000ug 2232 € MBS Recombinant Proteins human
GENTAUR-58bc9d7d799f3 Human Chymotrypsin-like elastase family member 2B (CELA2B) 100ug 1719 € MBS Recombinant Proteins human
GENTAUR-58bc9d7db7f70 Human Chymotrypsin-like elastase family member 2B (CELA2B) 1000ug 1719 € MBS Recombinant Proteins human
GENTAUR-58bc9d7e0fd7b Human Chymotrypsin-like elastase family member 2B (CELA2B) 100ug 2232 € MBS Recombinant Proteins human
GENTAUR-58bc9d7e64e98 Human Chymotrypsin-like elastase family member 2B (CELA2B) 1000ug 2232 € MBS Recombinant Proteins human
AE50862BO Bovine Chymotrypsin-like elastase family member 2A (CEL) ELISA Kit 96 wells plate 810 € ab-elisa elisas bovine
AE50862BO-96 Bovine Chymotrypsin-like elastase family member 2A (CEL) ELISA Kit 1x plate of 96 wells 671 € abebio bovine
GENTAUR-58bd7e8b2ea65 Dog Chymotrypsin-like elastase family member 1 (CELA1) 100ug 1719 € MBS Recombinant Proteins dog
GENTAUR-58bd7e8b9f489 Dog Chymotrypsin-like elastase family member 1 (CELA1) 1000ug 1719 € MBS Recombinant Proteins dog
GENTAUR-58bd7e8c0d74f Dog Chymotrypsin-like elastase family member 1 (CELA1) 100ug 2232 € MBS Recombinant Proteins dog
GENTAUR-58bd7e8c7f841 Dog Chymotrypsin-like elastase family member 1 (CELA1) 1000ug 2232 € MBS Recombinant Proteins dog
AE50862BO-48 ELISA test for Bovine Chymotrypsin-like elastase family member 2A (CEL) 1x plate of 48 wells 402 € abebio bovine
GENTAUR-58bb06411c039 Macaca mulatta Chymotrypsin-like elastase family member 3B (CELA3B) 100ug 1724 € MBS Recombinant Proteins human
GENTAUR-58bb0641a78af Macaca mulatta Chymotrypsin-like elastase family member 3B (CELA3B) 1000ug 1724 € MBS Recombinant Proteins human
GENTAUR-58bb0641e51f0 Macaca mulatta Chymotrypsin-like elastase family member 3B (CELA3B) 100ug 2232 € MBS Recombinant Proteins human
GENTAUR-58bb064238018 Macaca mulatta Chymotrypsin-like elastase family member 3B (CELA3B) 1000ug 2232 € MBS Recombinant Proteins human
GENTAUR-58bb31f13bd03 Macaca mulatta Chymotrypsin-like elastase family member 3B (CELA3B) 100ug 1724 € MBS Recombinant Proteins human
GENTAUR-58bb31f194004 Macaca mulatta Chymotrypsin-like elastase family member 3B (CELA3B) 1000ug 1724 € MBS Recombinant Proteins human
GENTAUR-58bb31f1e33a7 Macaca mulatta Chymotrypsin-like elastase family member 3B (CELA3B) 100ug 2232 € MBS Recombinant Proteins human
GENTAUR-58bb31f229c74 Macaca mulatta Chymotrypsin-like elastase family member 3B (CELA3B) 1000ug 2232 € MBS Recombinant Proteins human
GENTAUR-58bcef10a478e Mouse Chymotrypsin-like elastase family member 2A (Cela2a) 100ug 1719 € MBS Recombinant Proteins mouse