| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human GM-CSF Receptor alpha is produced by our Mammalian expression system and the target gene encoding Glu23-Gly320 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
35, 5 kD |
| UniProt number: |
P15509 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
CSF2 |
More about : CSF2 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD116 (C-6His), CSF2RA, GM-CSF R &alpha |
| Short name: |
CD116 (C-6His), CSF2RA, Recombinant GM-CSF R &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
CD116 (C-6His), a, colony stimulating factor 2 receptor, low-affinity (granulocyte-macrophage), sapiens GM-CSF R &alpha, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD116 and CDw116 and CSF2R and CSF2RAX and CSF2RAY and CSF2RX and CSF2RY and GM-CSF-R-alpha and GMCSFR and GMR and SMDP4, CSF2RA and IDBG-39400 and ENSG00000198223 and 102725415, CSF2RA and IDBG-642291 and ENSBTAG00000045948 and 100336606, Csf2ra and IDBG-182098 and ENSMUSG00000059326 and 12982, Extracellular, alpha, low-affinity (granulocyte-macrophage), protein binding, this GO :0004872 and receptor activity and molecular function this GO :0004896 and cytokine receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0045471 and response to ethanol and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0004896 : cytokine receptor activity and also this GO :0005515 : protein binding, this GO :0004896 : cytokine receptor activity, this GO :0005515 : protein binding, 1438, 511847, colony stimulating factor 2 receptor |
| Identity: |
2434 |
| Long gene name: |
colony stimulating factor 2 |
| Synonyms gene name: |
colony stimulating factor 2 (granulocyte-macrophage) |
| Synonyms: |
GM-CSF GMCSF |
| Synonyms name: |
sargramostim molgramostin granulocyte-macrophage colony stimulating factor |
| Locus: |
5q31, 1 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M11734 |
| Entrez gene record: |
1437 |
| Pubmed identfication: |
3898082 2999978 |
| RefSeq identity: |
NM_000758 |
| Havana BLAST/BLAT: |
OTTHUMG00000059637 |