Recombinant Human Trans-2-Enoyl-CoA Reductase Mitochondrial, MECR (C-6His)

Contact us
Catalog number: C917
Price: 1774 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Trans-2-Enoyl-CoA Reductase Mitochondrial, MECR (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Trans-2-Enoyl-CoA Reductase is produced by our Mammalian expression system and the target gene encoding Pro54-Met373 is expressed with a 6His tag at the C-terminus
Molecular Weight: 35, 7 kD
UniProt number: Q9BV79
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTMVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: MECR (C-6His), Trans-2-Enoyl-CoA Reductase Mitochondrial
Short name: MECR (C-6His), Recombinant Trans-2-Enoyl-CoA Reductase Mitochondrial
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: MECR (C-6His), sapiens Trans-2-Enoyl-CoA Reductase Mitochondrial, recombinant H
Alternative technique: rec
Identity: 19691
Gene: MECR | More about : MECR
Long gene name: mitochondrial trans-2-enoyl-CoA reductase
Synonyms: CGI-63 NRBF1 FASN2B ETR1
Synonyms name: nuclear receptor binding factor 1 mitochondrial 2-enoyl thioester reductase
Locus: 1p35, 3
Discovery year: 2005-05-24
Entrez gene record: 51102
Pubmed identfication: 9795230 12654921
RefSeq identity: NM_016011
Havana BLAST/BLAT: OTTHUMG00000059082

Related Products :

C917 Recombinant Human Trans-2-Enoyl-CoA Reductase Mitochondrial, MECR (C-6His) 10 µg 202 € novo human
GENTAUR-58bd6d823a678 Danio rerio Trans-2-enoyl-CoA reductase, mitochondrial (mecr) 100ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bd6d8283376 Danio rerio Trans-2-enoyl-CoA reductase, mitochondrial (mecr) 1000ug 1934 € MBS Recombinant Proteins human
GENTAUR-58bd6d82cb967 Danio rerio Trans-2-enoyl-CoA reductase, mitochondrial (mecr) 100ug 2448 € MBS Recombinant Proteins human
GENTAUR-58bd6d83075ee Danio rerio Trans-2-enoyl-CoA reductase, mitochondrial (mecr) 1000ug 2448 € MBS Recombinant Proteins human
GENTAUR-58b9e765696ca Probable trans-2-enoyl-CoA reductase 1, mitochondrial (W09H1.5) 100ug 1945 € MBS Recombinant Proteins human
GENTAUR-58b9e765bc335 Probable trans-2-enoyl-CoA reductase 1, mitochondrial (W09H1.5) 1000ug 1945 € MBS Recombinant Proteins human
GENTAUR-58b9e76625b18 Probable trans-2-enoyl-CoA reductase 1, mitochondrial (W09H1.5) 100ug 2459 € MBS Recombinant Proteins human
GENTAUR-58b9e766843b8 Probable trans-2-enoyl-CoA reductase 1, mitochondrial (W09H1.5) 1000ug 2459 € MBS Recombinant Proteins human
GENTAUR-58bb52da7fdcc Saccharomyces cerevisiae 3,2-trans-enoyl-CoA isomerase (ECI1) 100ug 1818 € MBS Recombinant Proteins human
GENTAUR-58bb52dacfb3a Saccharomyces cerevisiae 3,2-trans-enoyl-CoA isomerase (ECI1) 1000ug 1818 € MBS Recombinant Proteins human
GENTAUR-58bb52db24c47 Saccharomyces cerevisiae 3,2-trans-enoyl-CoA isomerase (ECI1) 100ug 2332 € MBS Recombinant Proteins human
GENTAUR-58bb52dba965a Saccharomyces cerevisiae 3,2-trans-enoyl-CoA isomerase (ECI1) 1000ug 2332 € MBS Recombinant Proteins human
GENTAUR-58bb3cbb57a91 Mycobacterium tuberculosis Trans-acting enoyl reductase (MRA_2980) 100ug 2172 € MBS Recombinant Proteins human
GENTAUR-58bb3cbba0410 Mycobacterium tuberculosis Trans-acting enoyl reductase (MRA_2980) 1000ug 2172 € MBS Recombinant Proteins human
GENTAUR-58bb3cbbe2859 Mycobacterium tuberculosis Trans-acting enoyl reductase (MRA_2980) 100ug 2685 € MBS Recombinant Proteins human
GENTAUR-58bb3cbc303cc Mycobacterium tuberculosis Trans-acting enoyl reductase (MRA_2980) 1000ug 2685 € MBS Recombinant Proteins human
GENTAUR-58ba913f988e1 Mycobacterium ulcerans Trans-acting enoyl reductase (MUL_2000) 100ug 2172 € MBS Recombinant Proteins human
GENTAUR-58ba9140337a4 Mycobacterium ulcerans Trans-acting enoyl reductase (MUL_2000) 1000ug 2172 € MBS Recombinant Proteins human
GENTAUR-58ba914097b8b Mycobacterium ulcerans Trans-acting enoyl reductase (MUL_2000) 100ug 2685 € MBS Recombinant Proteins human
GENTAUR-58ba9141057b4 Mycobacterium ulcerans Trans-acting enoyl reductase (MUL_2000) 1000ug 2685 € MBS Recombinant Proteins human
GENTAUR-58bd171590776 Human Enoyl-CoA delta isomerase 2, mitochondrial (ECI2) 100ug 2011 € MBS Recombinant Proteins human
GENTAUR-58bd1715cd98d Human Enoyl-CoA delta isomerase 2, mitochondrial (ECI2) 1000ug 2011 € MBS Recombinant Proteins human
GENTAUR-58bd17161f788 Human Enoyl-CoA delta isomerase 2, mitochondrial (ECI2) 100ug 2525 € MBS Recombinant Proteins human
GENTAUR-58bd17166e746 Human Enoyl-CoA delta isomerase 2, mitochondrial (ECI2) 1000ug 2525 € MBS Recombinant Proteins human
GENTAUR-58bd7022c2b16 Mouse Enoyl-CoA hydratase domain-containing protein 3, mitochondrial (Echdc3) 100ug 1702 € MBS Recombinant Proteins mouse
GENTAUR-58bd70231dcae Mouse Enoyl-CoA hydratase domain-containing protein 3, mitochondrial (Echdc3) 1000ug 1702 € MBS Recombinant Proteins mouse
GENTAUR-58bd702354076 Mouse Enoyl-CoA hydratase domain-containing protein 3, mitochondrial (Echdc3) 100ug 2216 € MBS Recombinant Proteins mouse
GENTAUR-58bd70239d1c8 Mouse Enoyl-CoA hydratase domain-containing protein 3, mitochondrial (Echdc3) 1000ug 2216 € MBS Recombinant Proteins mouse
GENTAUR-58bd9cc9f15fc Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) 100ug 1774 € MBS Recombinant Proteins mouse