Recombinant Human Trefoil Factor 2, TFF2 (C-6His)

Contact us
Catalog number: C878
Price: 141 €
Supplier: novo
Product name: Recombinant Human Trefoil Factor 2, TFF2 (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 2283€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Trefoil Factor 2 is produced by our Mammalian expression system and the target gene encoding Gln24-Tyr129 is expressed with a 6His tag at the C-terminus
Molecular Weight: 13 kD
UniProt number: Q03403
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHYVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TFF2 (C-6His), Trefoil Factor 2
Short name: TFF2 (C-6His), Recombinant Trefoil Factor 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: TFF2 (C-6His), sapiens Trefoil Factor 2, recombinant H
Alternative technique: rec
Identity: 11756
Gene: TFF2 | More about : TFF2
Long gene name: trefoil factor 2
Synonyms gene: SML1
Synonyms gene name: spasmolytic protein 1
Locus: 21q22, 3
Discovery year: 1991-12-13
Entrez gene record: 7032
Pubmed identfication: 1505966 9043862
RefSeq identity: NM_005423
Havana BLAST/BLAT: OTTHUMG00000086797

Related Products :

C878 Recombinant Human Trefoil Factor 2, TFF2 (C-6His) 1 mg 2283 € novo human
TFF22-C Recombinant (E. coli) Human Trefoil factor 2 (TFF2) protein control for WB 100 μL 333 € adi human
abx575433 Anti-Human Trefoil Factor 2 (TFF2) ELISA Kit inquire 50 € abbex human
TFF22-P Human Trefoil factor 2 (TFF2) Control/blocking peptide #2 100 μg 188 € adi human
DL-TFF2-Hu Human Trefoil Factor 2 TFF2 ELISA Kit 96T 846 € DL elisas human
TFF22-A Rabbit Anti-Human Trefoil factor 2 (TFF2) IgG # 2 (aff pure) 100 μg 565 € adi human
GWB-8CD578 Trefoil Factor 2 (TFF2) (Recomninant) Human 1 vial 579 € genways human
abx575522 Anti-Mouse Trefoil Factor 2 (TFF2) ELISA Kit 96 tests 746 € abbex mouse
GENTAUR-58bdc8badd72f Anti- Trefoil Factor 2 (TFF2) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc8bb523e7 Anti- Trefoil Factor 2 (TFF2) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc96ebbab3 Anti- Trefoil Factor 2 (TFF2) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdccd4985e7 Anti- Trefoil Factor 2 (TFF2) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdccf892c09 Anti- Trefoil Factor 2 (TFF2) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdccf91eeba Anti- Trefoil Factor 2 (TFF2) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdcd7e5501b Anti- Trefoil Factor 2 (TFF2) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdce6c646d9 Anti- Trefoil Factor 2 (TFF2) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdce6cc6764 Anti- Trefoil Factor 2 (TFF2) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdd6d910932 Anti- Trefoil Factor 2 (TFF2) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd7bd39acf Anti- Trefoil Factor 2 (TFF2) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd88565b1e Anti- Trefoil Factor 2 (TFF2) Antibody 100ug 553 € MBS Polyclonals human
abx219123 Anti-Trefoil factor 2 (TFF2) Antibody inquire 50 € abbex human
TFF21-P Mouse Trefoil factor 2 (TFF2) Control/blocking peptide #1 100 μg 188 € adi mouse
DL-TFF2-Mu Mouse Trefoil Factor 2 TFF2 ELISA Kit 96T 869 € DL elisas mouse
TFF21-A Rabbit Anti-Mouse Trefoil factor 2 (TFF2) IgG # 1 (aff pure) 100 μg 565 € adi mouse
DL-TFF2-Ra Rat Trefoil Factor 2 TFF2 ELISA Kit 96T 869 € DL elisas rat
MBS613620 Trefoil Factor 2 (TFF2) 100ug 774 € MBS Polyclonals_1 human
EKU07871 Trefoil Factor 2 (TFF2) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU07872 Trefoil Factor 2 (TFF2) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human
C659 Recombinant Human Trefoil Factor 1, TFF1 (C-6His) 500 µg 1471 € novo human
C660 Recombinant Mouse Trefoil Factor 1, TFF1 (C-6His) 10 µg 141 € novo mouse