Recombinant Human Carbonic Anhydrase-Related Protein 11, CA11 (C-6His)

Contact us
Catalog number: C823
Price: 612 €
Supplier: abebio
Product name: Recombinant Human Carbonic Anhydrase-Related Protein 11, CA11 (C-6His)
Quantity: 1x plate of 96 wells
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Carbonic Anhydrase 11 is produced by our Mammalian expression system and the target gene encoding His24-Arg328 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 35
UniProt number: O75493
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGRVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CA11 (C-6His), Carbonic Anhydrase-Related Protein 11
Short name: CA11 (C-6His), Recombinant Carbonic Anhydrase- Protein 11
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CA11 (C-6His), sapiens Carbonic Anhydrase-Related Protein 11, recombinant H
Alternative technique: rec
Identity: 1370
Gene: CA11 | More about : CA11
Long gene name: carbonic anhydrase 11
Synonyms gene name: carbonic anhydrase XI
Synonyms: CARP2 CARPX1
Synonyms name: CA-RP XI carbonic anhydrase-related protein XI carbonic anhydrase-related protein 2
Locus: 19q13, 33
Discovery year: 1998-07-17
GenBank acession: AF067662
Entrez gene record: 770
Pubmed identfication: 9878252
RefSeq identity: NM_001217
Classification: Carbonic anhydrases
Havana BLAST/BLAT: OTTHUMG00000183320

Related Products :

C823 Recombinant Human Carbonic Anhydrase-Related Protein 11, CA11 (C-6His) 10 µg 202 € novo human
GENTAUR-58b9e2cfe4c24 Human Carbonic anhydrase-related protein 11 (CA11) 100ug 1884 € MBS Recombinant Proteins human
GENTAUR-58b9e2d0496eb Human Carbonic anhydrase-related protein 11 (CA11) 1000ug 1884 € MBS Recombinant Proteins human
GENTAUR-58b9e2d0a7b0d Human Carbonic anhydrase-related protein 11 (CA11) 100ug 2398 € MBS Recombinant Proteins human
GENTAUR-58b9e2d0f2fd2 Human Carbonic anhydrase-related protein 11 (CA11) 1000ug 2398 € MBS Recombinant Proteins human
AE52802MO-48 ELISA test for Mouse Carbonic anhydrase-related protein 11 (CA11) 1x plate of 48 wells 373 € abebio mouse
GENTAUR-58bb6f2a1bb7a Mouse Carbonic anhydrase-related protein 11 (Ca11) 100ug 1884 € MBS Recombinant Proteins mouse
GENTAUR-58bb6f2a6879e Mouse Carbonic anhydrase-related protein 11 (Ca11) 1000ug 1884 € MBS Recombinant Proteins mouse
GENTAUR-58bb6f2aa3ffb Mouse Carbonic anhydrase-related protein 11 (Ca11) 100ug 2398 € MBS Recombinant Proteins mouse
GENTAUR-58bb6f2ae86f7 Mouse Carbonic anhydrase-related protein 11 (Ca11) 1000ug 2398 € MBS Recombinant Proteins mouse
AE52802MO-96 Mouse Carbonic anhydrase-related protein 11 (CA11) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
MBS624510 CA9, ID (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623542 CA9, NT (Carbonic Anhydrase 9, Carbonic Anhydrase IX, Carbonate Dehydratase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-associated Antigen G250, RCC-associated Antigen G250, pMW1, G250, MN) Antibody 200ul 603 € MBS Polyclonals_1 human
C107 Recombinant Human Carbonic Anhydrase 1, CA1 (C-6His) 10 µg 110 € novo human
C305 Recombinant Human Carbonic Anhydrase 10, CA10 (C-6His) 1 mg 2283 € novo human
CE99 Recombinant Human Carbonic Anhydrase 10, CA10 (N-6His) 500 µg 1613 € novo human
C108 Recombinant Human Carbonic Anhydrase 13, CA13 (C-6His) 1 mg 2283 € novo human
CG12 Recombinant Human Carbonic Anhydrase 14, CA14 (N-6His) 500 µg 1755 € novo human
CF26 Recombinant Human Carbonic Anhydrase 3, CA3 (C-6His) 50 µg 339 € novo human
C109 Recombinant Human Carbonic Anhydrase 4, CA4 (C-6His) 50 µg 496 € novo human
C110 Recombinant Human Carbonic Anhydrase 5B, CA5B (C-6His) 500 µg 1613 € novo human
C111 Recombinant Human Carbonic Anhydrase 7, CA7 (C-6His) 50 µg 232 € novo human
C112 Recombinant Human Carbonic Anhydrase 8, CA8 (C-6His) 10 µg 110 € novo human
CK69 Recombinant Mouse Carbonic Anhydrase 12, CA12 (C-6His) 500 µg 1613 € novo mouse
CJ84 Recombinant Mouse Carbonic Anhydrase 14, CA14 (C-6His) 10 µg 202 € novo mouse
CC15 Recombinant Mouse Carbonic Anhydrase 4, CAIV, CA4 (C-6His) 1 mg 2486 € novo mouse
MBS615493 CARBONIC ANHYDRASE-RELATED PROTEIN Antibody 100ul 603 € MBS Polyclonals_1 human
AE52805MO-48 ELISA test for Mouse Carbonic anhydrase-related protein 10 (CA10) 1x plate of 48 wells 373 € abebio mouse
AE52759MO-48 ELISA test for Mouse Carbonic anhydrase-related protein (CA8) 1x plate of 48 wells 373 € abebio mouse
AE52805MO-96 Mouse Carbonic anhydrase-related protein 10 (CA10) ELISA Kit 1x plate of 96 wells 612 € abebio mouse