Recombinant Human Triggering Receptor Expressed On Myeloid 2, TREM-2 (C-6His)

Contact us
Catalog number: C807
Price: 520 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Triggering Receptor Expressed On Myeloid 2, TREM-2 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 1674€ 50 µg 303€ 500 µg 1186€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Triggering Receptor Expressed On Myeloid Cells 2 is produced by our Mammalian expression system and the target gene encoding His19-Ser174 is expressed with a 6His tag at the C-terminus
Molecular Weight: 18, 3 kD
UniProt number: Q9NZC2
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TREM-2 (C-6His), Triggering Receptor Expressed On Myeloid 2
Short name: TREM-2 (C-6His), Recombinant Triggering Receptor Expressed On Myeloid 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: TREM-2 (C-6His), sapiens Triggering Receptor Expressed On Myeloid 2, recombinant H
Alternative technique: rec
Identity: 17761
Gene: TREM2 | More about : TREM2
Long gene name: triggering receptor expressed on myeloid cells 2
Synonyms gene name: triggering receptor expressed on myeloid cells 2a
Synonyms: TREM-2 Trem2a Trem2b Trem2c
Locus: 6p21, 1
Discovery year: 2002-08-09
GenBank acession: AF213457
Entrez gene record: 54209
Pubmed identfication: 10799849 12080485
RefSeq identity: NM_018965
Classification: V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000014671
Locus Specific Databases: LRG_631

Related Products :

MBS620836 TREM-1 (Triggering receptor expressed on monocytes 1, Triggering receptor expressed on myeloid cells 1 precursor) 1 mililiter 713 € MBS Polyclonals_1 human
C807 Recombinant Human Triggering Receptor Expressed On Myeloid 2, TREM-2 (C-6His) 50 µg 303 € novo human
CM92 Recombinant Mouse Triggering Receptor Expressed on Myeloid Cells 2b, TREM-2b (C-6His) 50 µg 303 € novo mouse
CM91 Recombinant Mouse Triggering Receptor Expressed on Myeloid Cells 2b, TREM-2b (C-Fc) 1 mg 2283 € novo mouse
MBS622648 TREM-2 (Trem2, Triggering Receptor Expressed on Monocytes 2) 100ug 591 € MBS Polyclonals_1 human
MBS616788 TREML2 (Triggering Receptor Expressed on Monocytes-Like Protein 2, TREM-Like Transcript 2, TLT-2) 100ug 774 € MBS Polyclonals_1 human
abx166282 Anti-Triggering Receptor Expressed On Myeloid Cells 1 Protein (Recombinant) 100 μg 905 € abbex human
abx262303 Anti-Triggering Receptor Expressed on Myeloid Cells 1 Protein (Recombinant) 1 mg 6169 € abbex human
abx167352 Anti-Triggering Receptor Expressed On Myeloid Cells 2 Protein (Recombinant) 10 μg 412 € abbex human
abx167723 Anti-Triggering Receptor Expressed On Myeloid Cells 2 Protein (Recombinant) 100 μg 905 € abbex human
abx262727 Anti-Triggering Receptor Expressed on Myeloid Cells 2 Protein (Recombinant) 2 µg 238 € abbex human
abx253226 Anti-Human soluble Triggering Receptor Expressed on Myeloid Cells-1 ELISA Kit 96 tests 557 € abbex human
abx190092 Anti-Human Triggering Receptor Expressed On Myeloid Cells 1 CLIA Kit inquire 50 € abbex human
abx253495 Anti-Human Triggering receptor expressed on myeloid cells 1 ELISA Kit inquire 50 € abbex human
abx250733 Anti-Human Triggering receptor expressed on myeloid cells 2 ELISA Kit inquire 50 € abbex human
DL-TREM1-Hu Human Triggering Receptor Expressed On Myeloid Cells 1 TREM1 ELISA Kit 96T 846 € DL elisas human
DL-TREM2-Hu Human Triggering Receptor Expressed On Myeloid Cells 2 TREM2 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bdc0aeb2f39 Mouse Anti-Human Triggering receptor expressed on myeloid cells 2 Antibody 0.005 miligrams 205 € MBS mono human
GENTAUR-58bdc0af0dcac Mouse Anti-Human Triggering receptor expressed on myeloid cells 2 Antibody 100ug 608 € MBS mono human
GENTAUR-58bdc0af512f4 Mouse Anti-Human Triggering receptor expressed on myeloid cells 2 Antibody 0.02 miligrams 277 € MBS mono human
GWB-FAC583 Triggering Receptor Expressed On Myeloid Cells 2 (TREM2) Goat antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
GENTAUR-58bdca3272e01 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdca32c80f1 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcb5bd4692 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 50ug 293 € MBS Polyclonals human
GENTAUR-58bdcb5c53901 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 354 € MBS Polyclonals human
GENTAUR-58bdd2a044cce Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd35c5aebb Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd583709eb Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd6d6bb651 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 597 € MBS Polyclonals human
GENTAUR-58bdd97f28423 Anti- Triggering Receptor Expressed On Myeloid Cells 1 (TREM1) Antibody 100ug 520 € MBS Polyclonals human