Recombinant Mouse Fc γ RII, CD32b, FCGR2 (C-6His)

Contact us
Catalog number: C767
Price: 475 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Mouse Fc γ RII, CD32b, FCGR2 (C-6His)
Quantity: 200ug
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Fc gamma RII is produced by our Mammalian expression system and the target gene encoding Thr30-Pro210 is expressed with a 6His tag at the C-terminus
Molecular Weight: 21, 6 kD
UniProt number: P08101
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD32b, FCGR2 (C-6His), RII, Fc &gamma
Short name: CD32b, FCGR2 (C-6His), RII, Recombinant Mouse Fc &gamma
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses
Alternative name: CD32b, FCGR2 (C-6His), RII, recombinant Mouse fragment c &gamma
Alternative technique: rec
Identity: 3618
Gene: FCGR2B | More about : FCGR2B
Long gene name: Fc fragment of IgG receptor IIb
Synonyms gene: FCG2 FCGR2
Synonyms gene name: Fc fragment of IgG, low affinity IIb, low affinity IIb, receptor (CD32) , receptor for (CD32) Fc fragment of IgG
Synonyms: CD32 CD32B
Synonyms name: Fc gamma receptor IIb
Locus: 1q23, 3
Discovery year: 1991-08-21
GenBank acession: BC031992
Entrez gene record: 2213
Pubmed identfication: 2139735
RefSeq identity: NM_004001
Classification: CD molecules Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000034470

Related Products :

C767 Recombinant Mouse Fc γ RII, CD32b, FCGR2 (C-6His) 50 µg 303 € novo human
C444 Recombinant Human Fc γ RIIb, CD32b (C-6His) 10 µg 131 € novo human
MBS620042 Tubulin, gamma (TUBG, Tubulin gamma 1 Chain, TUBG1, Tubulin gamma 2 Chain, TUBG2, Gamma 1 Tubulin, Gamma 2 Tubulin, Gamma Tubulin 1, Gamma Tubulin 2, Gamma Tubulin Complex Component 1, GCP 1, GCP-1, MGC131994, Xgam) (Cy3) Antibody 100ul 696 € MBS Polyclonals_1 human
CP32 Recombinant Mouse IL-1 Receptor Type 2, IL-1 RII (C-6His) 1 mg 2283 € novo mouse
MBS624493 FCGR2B (CD32, Low Affinity Immunoglobulin gamma Fc Region Receptor II-b, IgG Fc Receptor II-b, CDw32, Fc-gamma RII-b, Fc-gamma-RIIb, FcRII-b, CD32, FCG2, IGFR2) Antibody 50ug 619 € MBS Polyclonals_1 human
GENTAUR-58b383e1e2fc9 Mouse Low affinity immunoglobulin gamma Fc region receptor II (Fcgr2) 100ug 1575 € MBS Recombinant Proteins mouse
GENTAUR-58b383e221d47 Mouse Low affinity immunoglobulin gamma Fc region receptor II (Fcgr2) 1000ug 1575 € MBS Recombinant Proteins mouse
GENTAUR-58b383e25a27f Mouse Low affinity immunoglobulin gamma Fc region receptor II (Fcgr2) 100ug 2078 € MBS Recombinant Proteins mouse
GENTAUR-58b383e282789 Mouse Low affinity immunoglobulin gamma Fc region receptor II (Fcgr2) 1000ug 2078 € MBS Recombinant Proteins mouse
GENTAUR-58b43e76a3cf0 Mouse Low affinity immunoglobulin gamma Fc region receptor II (Fcgr2) 100ug 1575 € MBS Recombinant Proteins mouse
GENTAUR-58b43e770250b Mouse Low affinity immunoglobulin gamma Fc region receptor II (Fcgr2) 1000ug 1575 € MBS Recombinant Proteins mouse
GENTAUR-58b43e77620c9 Mouse Low affinity immunoglobulin gamma Fc region receptor II (Fcgr2) 100ug 2078 € MBS Recombinant Proteins mouse
GENTAUR-58b43e77b7174 Mouse Low affinity immunoglobulin gamma Fc region receptor II (Fcgr2) 1000ug 2078 € MBS Recombinant Proteins mouse
GENTAUR-58bdb6f6dddac Bovine Low affinity immunoglobulin gamma Fc region receptor II (FCGR2) 100ug 1580 € MBS Recombinant Proteins bovine
GENTAUR-58bdb6f7443ff Bovine Low affinity immunoglobulin gamma Fc region receptor II (FCGR2) 1000ug 1580 € MBS Recombinant Proteins bovine
GENTAUR-58bdb6f7ba34e Bovine Low affinity immunoglobulin gamma Fc region receptor II (FCGR2) 100ug 2083 € MBS Recombinant Proteins bovine
GENTAUR-58bdb6f82e735 Bovine Low affinity immunoglobulin gamma Fc region receptor II (FCGR2) 1000ug 2083 € MBS Recombinant Proteins bovine
RP-1185RC Recombinant Cynomolgus CD32b / FCGR2B Protein (His & AVI Tag), Biotinylated 50μg 659 € adv human
RP-1181RC Recombinant Cynomolgus CD32b / FCGR2B Protein (His Tag) 50μg 659 € adv human
RP-1685H Recombinant Human CD32b / FCGR2B Protein (His & AVI Tag), Biotinylated 20μg 624 € adv human
RP-0317H Recombinant Human CD32b / FCGR2B Protein (His Tag) 50μg 624 € adv human
RP-2047R Recombinant Rat CD32b / FCGR2B Protein (His Tag) 50μg 659 € adv rat
OBT0570B CD32, Fc gamma RII, 40kD, Clone: AT10, Mouse Monoclonal antibody-Human, Biotin; flow 0.1 mg Ask price € accurate-monoclonals human
OBT0570F CD32, Fc gamma RII, 40kD, Clone: AT10, Mouse Monoclonal antibody-Human, FITC; flow 100 tests Ask price € accurate-monoclonals human
OBT0570Z CD32, Fc gamma RII, 40kD, Clone: AT10, Mouse Monoclonal antibody-Human, Rhesus Monkey, Dog Neutrophils, azide-free; frozen, IH/flow/IP/Blocking 1 mg Ask price € accurate-monoclonals dog
OBT0570 CD32, Fc gamma RII, 40kD, Clone: AT10, Mouse Monoclonal antibody-Human, Rhesus Monkey, Dog Neutrophils; frozen, IH/flow/IP 200ug Ask price € accurate-monoclonals dog
OBT0570R CD32, Fc gamma RII, 40kD, Clone: AT10, Mouse Monoclonal antibody-Human, RPE; flow 100 tests Ask price € accurate-monoclonals human
abx916691 Anti-FCGR2 siRNA inquire 50 € abbex human
abx916692 Anti-FCGR2 siRNA 30 nmol 717 € abbex human
MBS551009 Anti-Mouse CD32b (FCGR2B) Polyclonal 200ug 475 € MBS Polyclonals_1 mouse