| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Vaccinia Virus VH1-related Phosphatase is produced by our E, coli expression system and the target gene encoding Ser2-Pro185 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
22, 6 kD |
| UniProt number: |
P51452 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
DUSP3 (N-6His), Protein Phosphatase 3 |
| Short name: |
DUSP3 (N-6His), Recombinant Dual Protein Phosphatase 3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
dual specificity phosphatase 3 (N-6His), sapiens Dual Specificity Protein Phosphatase 3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
DUSP3 and IDBG-52945 and ENSG00000108861 and 1845, DUSP3 and IDBG-640759 and ENSBTAG00000003966 and 615432, Dusp3 and IDBG-212400 and ENSMUSG00000003518 and 72349, MAP kinase phosphatase activity, VHR, nuclei, this GO :0000188 and inactivation of MAPK activity and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001772 and immunological synapse and cellular component this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0002755 and MyD88-dependent toll-like receptor signaling pathway and biological process this GO :0002756 and MyD88-independent toll-like receptor signaling pathway and biological process this GO :0004721 and phosphoprotein phosphatase activity and molecular function this GO :0004725 and protein tyrosine phosphatase activity and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006470 and protein dephosphorylation and biological process this GO :0008138 and protein tyrosine/serine/threonine phosphatase activity and molecular function this GO :0016311 and dephosphorylation and biological process this GO :0016791 and phosphatase activity and molecular function this GO :0033549 and MAP kinase phosphatase activity and molecular function this GO :0034134 and toll-like receptor 2 signaling pathway and biological process this GO :0034138 and toll-like receptor 3 signaling pathway and biological process this GO :0034142 and toll-like receptor 4 signaling pathway and biological process this GO :0034146 and toll-like receptor 5 signaling pathway and biological process this GO :0034162 and toll-like receptor 9 signaling pathway and biological process this GO :0034166 and toll-like receptor 10 signaling pathway and biological process this GO :0035335 and peptidyl-tyrosine dephosphorylation and biological process this GO :0035666 and TRIF-dependent toll-like receptor signaling pathway and biological process this GO :0038123 and toll-like receptor TLR1:TLR2 signaling pathway and biological process this GO :0038124 and toll-like receptor TLR6:TLR2 signaling pathway and biological process this GO :0043409 and negative regulation of MAPK cascade and biological process this GO :0045087 and innate immune response and biological process this GO :0045931 and positive regulation of mitotic cell cycle and biological process this GO :0046329 and negative regulation of JNK cascade and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0050860 and negative regulation of T cell receptor signaling pathway and biological process this GO :0050868 and negative regulation of T cell activation and biological process this GO :0051403 and stress-activated MAPK cascade and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070373 and negative regulation of ERK1 and ERK2 cascade and biological process, this GO :0004721 : phosphoprotein phosphatase activity, this GO :0004721 : phosphoprotein phosphatase activity and also this GO :0004725 : protein tyrosine phosphatase activity and also this GO :0008138 : protein tyrosine/serine/threonine phosphatase activity and also this GO :0016791 : phosphatase activity and also this GO :0033549 : MAP kinase phosphatase activity, this GO :0004725 : protein tyrosine phosphatase activity, this GO :0008138 : protein tyrosine/serine/threonine phosphatase activity, this GO :0016791 : phosphatase activity, this GO :0033549 : MAP kinase phosphatase activity, dual specificity phosphatase 3 |
| Identity: |
3069 |
| Gene: |
DUSP3 |
More about : DUSP3 |
| Long gene name: |
dual specificity phosphatase 3 |
| Synonyms gene: |
VHR |
| Synonyms gene name: |
vaccinia virus phosphatase VH1-related |
| Locus: |
17q21, 31 |
| Discovery year: |
1994-05-19 |
| GenBank acession: |
BC035701 |
| Entrez gene record: |
1845 |
| Pubmed identfication: |
7829094 |
| RefSeq identity: |
NM_004090 |
| Classification: |
Atypical dual specificity phosphatases |
| Havana BLAST/BLAT: |
OTTHUMG00000180889 |