Recombinant Human Dual Specificity Protein Phosphatase 3, DUSP3 (N-6His)

Contact us
Catalog number: C745
Price: 659 €
Supplier: abbex
Product name: Recombinant Human Dual Specificity Protein Phosphatase 3, DUSP3 (N-6His)
Quantity: 96 tests
Other quantities: 1 mg 2283€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Vaccinia Virus VH1-related Phosphatase is produced by our E, coli expression system and the target gene encoding Ser2-Pro185 is expressed with a 6His tag at the N-terminus
Molecular Weight: 22, 6 kD
UniProt number: P51452
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: DUSP3 (N-6His), Protein Phosphatase 3
Short name: DUSP3 (N-6His), Recombinant Dual Protein Phosphatase 3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: dual specificity phosphatase 3 (N-6His), sapiens Dual Specificity Protein Phosphatase 3, recombinant H
Alternative technique: rec
Alternative to gene target: DUSP3 and IDBG-52945 and ENSG00000108861 and 1845, DUSP3 and IDBG-640759 and ENSBTAG00000003966 and 615432, Dusp3 and IDBG-212400 and ENSMUSG00000003518 and 72349, MAP kinase phosphatase activity, VHR, nuclei, this GO :0000188 and inactivation of MAPK activity and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001772 and immunological synapse and cellular component this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0002755 and MyD88-dependent toll-like receptor signaling pathway and biological process this GO :0002756 and MyD88-independent toll-like receptor signaling pathway and biological process this GO :0004721 and phosphoprotein phosphatase activity and molecular function this GO :0004725 and protein tyrosine phosphatase activity and molecular function this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006470 and protein dephosphorylation and biological process this GO :0008138 and protein tyrosine/serine/threonine phosphatase activity and molecular function this GO :0016311 and dephosphorylation and biological process this GO :0016791 and phosphatase activity and molecular function this GO :0033549 and MAP kinase phosphatase activity and molecular function this GO :0034134 and toll-like receptor 2 signaling pathway and biological process this GO :0034138 and toll-like receptor 3 signaling pathway and biological process this GO :0034142 and toll-like receptor 4 signaling pathway and biological process this GO :0034146 and toll-like receptor 5 signaling pathway and biological process this GO :0034162 and toll-like receptor 9 signaling pathway and biological process this GO :0034166 and toll-like receptor 10 signaling pathway and biological process this GO :0035335 and peptidyl-tyrosine dephosphorylation and biological process this GO :0035666 and TRIF-dependent toll-like receptor signaling pathway and biological process this GO :0038123 and toll-like receptor TLR1:TLR2 signaling pathway and biological process this GO :0038124 and toll-like receptor TLR6:TLR2 signaling pathway and biological process this GO :0043409 and negative regulation of MAPK cascade and biological process this GO :0045087 and innate immune response and biological process this GO :0045931 and positive regulation of mitotic cell cycle and biological process this GO :0046329 and negative regulation of JNK cascade and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0050860 and negative regulation of T cell receptor signaling pathway and biological process this GO :0050868 and negative regulation of T cell activation and biological process this GO :0051403 and stress-activated MAPK cascade and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070373 and negative regulation of ERK1 and ERK2 cascade and biological process, this GO :0004721 : phosphoprotein phosphatase activity, this GO :0004721 : phosphoprotein phosphatase activity and also this GO :0004725 : protein tyrosine phosphatase activity and also this GO :0008138 : protein tyrosine/serine/threonine phosphatase activity and also this GO :0016791 : phosphatase activity and also this GO :0033549 : MAP kinase phosphatase activity, this GO :0004725 : protein tyrosine phosphatase activity, this GO :0008138 : protein tyrosine/serine/threonine phosphatase activity, this GO :0016791 : phosphatase activity, this GO :0033549 : MAP kinase phosphatase activity, dual specificity phosphatase 3
Identity: 3069
Gene: DUSP3 | More about : DUSP3
Long gene name: dual specificity phosphatase 3
Synonyms gene: VHR
Synonyms gene name: vaccinia virus phosphatase VH1-related
Locus: 17q21, 31
Discovery year: 1994-05-19
GenBank acession: BC035701
Entrez gene record: 1845
Pubmed identfication: 7829094
RefSeq identity: NM_004090
Classification: Atypical dual specificity phosphatases
Havana BLAST/BLAT: OTTHUMG00000180889

Related Products :

C745 Recombinant Human Dual Specificity Protein Phosphatase 3, DUSP3 (N-6His) 1 mg 2283 € novo human
MBS614795 DUSP1 (Dual Specificity Protein Phosphatase 1, CL100, Dual Specificity Protein Phosphatase hVH1, HVH1, Mitogen-activated Protein Kinase Phosphatase 1, MAP Kinase Phosphatase 1, MKP1, MKP-1, Protein-tyrosine Phosphatase CL100, PTPN10, VH1) 100ug 735 € MBS Polyclonals_1 human
MBS613868 DUSP6a (Dual Specificity Protein Phosphatase 6 Isoform a, DUSP6, Dual Specificity Protein Phosphatase PYST1, Mitogen-activated Protein Kinase Phosphatase 3, MAP Kinase Phosphatase 3, MKP3, MKP-3, PYST1) Antibody 50ug 884 € MBS Polyclonals_1 human
MBS611536 DUSP13 (Dual Specificity Phosphatase 13, BEDP, Dual Specificity Phosphatase SKRP4, FLJ32450, MDSP, Testis-and Skeletal-muscle-specific DSP, TMDP) Antibody 100ug 558 € MBS Polyclonals_1 human
GENTAUR-58bdc90423526 Anti- Dual Specificity Phosphatase 3 (DUSP3) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdc904a68b9 Anti- Dual Specificity Phosphatase 3 (DUSP3) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdce76d1cda Anti- Dual Specificity Phosphatase 3 (DUSP3) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd7c34ed89 Anti- Dual Specificity Phosphatase 3 (DUSP3) Antibody 100ug 564 € MBS Polyclonals human
MBS610086 DUSP10 (Dual Specificity Protein Phosphatase 10, Mitogen Activated Protein Kinase Phosphatase 5, MAP Kinase Phosphatase 5, MKP5, MKP-5) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS622529 DUSP10 (Dual Specificity Protein Phosphatase 10, Mitogen Activated Protein Kinase Phosphatase 5, MAP Kinase Phosphatase 5, MKP5, MKP-5) Antibody 100ug 752 € MBS Polyclonals_1 human
MBS620301 DUSP16 (Dual Specificity Protein Phosphatase 16, KIAA1700, Mitogen-activated Protein Kinase Phosphatase 7, MAP Kinase Phosphatase 7, MKP7, MKP-7) 100ug 763 € MBS Polyclonals_1 human
MBS615785 DUSP16 (Dual Specificity Protein Phosphatase 16, KIAA1700, Mitogen-activated Protein Kinase Phosphatase 7, MAP Kinase Phosphatase 7, MKP7, MKP-7) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS616923 DUSP9 (Dual Specificity Protein Phosphatase 9, Mitogen Activated Protein Kinase Phosphatase 4, MAP Kinase Phosphatase 4, MKP4, MKP-4) Antibody 50ug 625 € MBS Polyclonals_1 human
GENTAUR-58ba21b828534 Mouse Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (Pten) 100ug 2133 € MBS Recombinant Proteins mouse
GENTAUR-58ba21b8abfd9 Mouse Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (Pten) 1000ug 2133 € MBS Recombinant Proteins mouse
GENTAUR-58ba21b92eecc Mouse Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (Pten) 100ug 2647 € MBS Recombinant Proteins mouse
GENTAUR-58ba21b9d1ead Mouse Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (Pten) 1000ug 2647 € MBS Recombinant Proteins mouse
MBS624461 CDC25A, phosphorylated (Ser124) (M-phase Inducer Phosphatase 1, Dual Specificity Phosphatase Cdc25A) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS610048 CDC25C (Cell Division Cycle 25 Homolog C, Cdc 25C, CDC 25, Dual Specificity Phosphatase Cdc25C, M-phase Inducer Phosphatase 3, MPIP3, PPP1R60) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS610272 CDC25C, Isoform b (Cell Division Cycle 25 Homolog C, Cdc 25C, CDC 25, Dual Specificity Phosphatase Cdc25C, M-phase Inducer Phosphatase 3, MPIP3, PPP1R60) 50ug 625 € MBS Polyclonals_1 human
MBS618392 CDC25C, phosphorylated (Ser216) (Cell Division Cycle 25 Homolog C, Cdc 25C, CDC 25, Dual Specificity Phosphatase Cdc25C, M-phase Inducer Phosphatase 3, MPIP3, PPP1R60) Antibody 100ug 531 € MBS Polyclonals_1 human
MBS614116 CDC25C, phosphorylated (Thr48) (Cell Division Cycle 25 Homolog C, Cdc 25C, CDC 25, Dual Specificity Phosphatase Cdc25C, M-phase Inducer Phosphatase 3, MPIP3, PPP1R60) Antibody 100ul 603 € MBS Polyclonals_1 human
MBS613091 DUSP8 (Dual Specificity Phosphatase 8, H1 Phosphatase Vaccinia Virus Homolog, HB5, HVH5, HVH8) Antibody 50ug 625 € MBS Polyclonals_1 virus
MBS614751 DUSP8 (Dual Specificity Phosphatase 8, H1 Phosphatase Vaccinia Virus Homolog, HB5, HVH5, HVH8) Antibody 100ug 558 € MBS Polyclonals_1 virus
MBS618960 DUSP8 (Dual Specificity Phosphatase 8, H1 Phosphatase Vaccinia Virus Homolog, HB5, HVH5, HVH8) Antibody 100ug 735 € MBS Polyclonals_1 virus
abx166899 Anti-Dual Specificity Phosphatase 5 Protein (Recombinant) 50 μg 601 € abbex human
abx167422 Anti-Dual Specificity Phosphatase 5 Protein (Recombinant) 50 μg 615 € abbex human
abx168255 Anti-Dual Specificity Phosphatase 6 Protein (Recombinant) 10 μg 412 € abbex human
abx251899 Anti-Human Dual specificity protein phosphatase 1 ELISA Kit 96 tests 659 € abbex human
abx250672 Anti-Human Dual specificity protein phosphatase 4 ELISA Kit 96 tests 659 € abbex human