Recombinant Mouse Interleukin-36 α, Il36a, IL-1F6

Catalog number:	C742 Buy Now
Price:	623 €
Supplier:	accurate-monoclonals
Product name:	Recombinant Mouse Interleukin-36 α, Il36a, IL-1F6
Quantity:	50 tests
Other quantities:	10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:	gene alpha recombinant ila synonyms culture

More details Need more?:

Reacts with:	Mouse
Source:	proteins, Recombinants or rec
Description:	Recombinant Mouse Interleukin-36 alpha is produced by our E, coli expression system and the target gene encoding Arg8-His160 is expressed
Molecular Weight:	17, 27 kD
UniProt number:	Q9JLA2
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Test:	A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or
Latin name:	Mus musculus
Group:	recombinants
Gene target:	IL-1F6, Il36a, Interleukin-36 &alpha
Short name:	IL-1F6, Il36a, Recombinant Mouse Interleukin-36 &alpha
Technique:	E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Mouses
Alternative name:	Interleukin-1F6, alpha, interleukin 36, recombinant Mouse Interleukin-36 &alpha
Alternative technique:	rec
Identity:	15562
Gene:	IL36A | More about : IL36A
Long gene name:	alpha , interleukin 36
Synonyms gene:	IL1F6
Synonyms gene name:	interleukin 1 family, member 6 (epsilon)
Synonyms:	FIL1 FIL1E IL-1F6 IL1(EPSILON) MGC129553 MGC129552
Locus:	2q14, 1
Discovery year:	2002-08-02
GenBank acession:	AF201831
Entrez gene record:	27179
Pubmed identfication:	10625660
RefSeq identity:	NM_014440
Classification:	Interleukins
Havana BLAST/BLAT:	OTTHUMG00000153320

• #gene
• #alpha
• #recombinant
• #ila
• #synonyms
• #culture