| Catalog number: | C742 |
|---|---|
| Price: | 623 € |
| Supplier: | accurate-monoclonals |
| Product name: | Recombinant Mouse Interleukin-36 α, Il36a, IL-1F6 |
| Quantity: | 50 tests |
| Other quantities: | 10 µg 156€ 50 µg 369€ 500 µg 1613€ |
| Related search: |
| Reacts with: | Mouse |
|---|---|
| Source: | proteins, Recombinants or rec |
| Description: | Recombinant Mouse Interleukin-36 alpha is produced by our E, coli expression system and the target gene encoding Arg8-His160 is expressed |
| Molecular Weight: | 17, 27 kD |
| UniProt number: | Q9JLA2 |
| State of the product: | Freeze-dried |
| Shipping conditions: | Ambient temperature |
| Formulation: | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: | MRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH |
| Levels of endotoxin: | 11 IEU/ug, LAL test shows less than than 0 |
| Test: | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: | Mus musculus |
| Group: | recombinants |
| Gene target: | IL-1F6, Il36a, Interleukin-36 &alpha |
| Short name: | IL-1F6, Il36a, Recombinant Mouse Interleukin-36 &alpha |
| Technique: | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: | Mouses |
| Alternative name: | Interleukin-1F6, alpha, interleukin 36, recombinant Mouse Interleukin-36 &alpha |
| Alternative technique: | rec |
| Identity: | 15562 |
| Gene: | IL36A | More about : IL36A |
| Long gene name: | alpha , interleukin 36 |
| Synonyms gene: | IL1F6 |
| Synonyms gene name: | interleukin 1 family, member 6 (epsilon) |
| Synonyms: | FIL1 FIL1E IL-1F6 IL1(EPSILON) MGC129553 MGC129552 |
| Locus: | 2q14, 1 |
| Discovery year: | 2002-08-02 |
| GenBank acession: | AF201831 |
| Entrez gene record: | 27179 |
| Pubmed identfication: | 10625660 |
| RefSeq identity: | NM_014440 |
| Classification: | Interleukins |
| Havana BLAST/BLAT: | OTTHUMG00000153320 |
| C742 | Recombinant Mouse Interleukin-36 α, Il36a, IL-1F6 | 500 µg | 1613 € | novo | human |
| abx262386 | Anti-IL36A 153 a.a. Protein (Recombinant) | 10 µg | 340 € | abbex | human |
| abx262384 | Anti-IL36A 158 a.a. Protein (Recombinant) | 2 µg | 238 € | abbex | human |
| abx262950 | Anti-IL36A Protein (Recombinant) | 2 µg | 238 € | abbex | human |
| abx262953 | Anti-IL36A Protein (Recombinant) | 10 µg | 340 € | abbex | human |
| RP-0876H | Recombinant Human IL1F6 / IL36A Protein (His Tag) | 10μg | 572 € | adv | human |
| abx251372 | Anti-Human IL36A ELISA Kit | inquire | 50 € | abbex | human |
| abx920515 | Anti-IL36A siRNA | inquire | 50 € | abbex | human |
| abx920516 | Anti-IL36A siRNA | 30 nmol | 717 € | abbex | human |
| GENTAUR-58be379983a39 | IL36A antibody | 100ul | 630 € | MBS mono | human |
| GENTAUR-58be39ce59e12 | IL36A antibody | 100ul | 707 € | MBS mono | human |
| GWB-MW593H | IL36A antibody | 1 vial | 521 € | genways | human |
| YM8078 | CD4, recombinant human, Mouse Monoclonal antibody-Human; Clone: 1F6 | 1000ul | 3148 € | accurate-monoclonals | human |
| GENTAUR-58be67fd3bf17 | Anti-TNF-alpha (1F6) Monoclonal, ALEXA Fluor 594 | 102 microliters | 489 € | Bioss Monoclonal Antibodies | human |
| bsm-0387M-Biotin | TNF-alpha (1F6) Antibody, Biotin Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |
| bsm-0387M-Cy3 | TNF-alpha (1F6) Antibody, Cy3 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bsm-0387M-Cy5 | TNF-alpha (1F6) Antibody, Cy5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bsm-0387M-Cy5.5 | TNF-alpha (1F6) Antibody, Cy5.5 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bsm-0387M-Cy7 | TNF-alpha (1F6) Antibody, Cy7 Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bsm-0387M-FITC | TNF-alpha (1F6) Antibody, FITC Conjugated | 0.1ml | 333 € | Bioss Primary Conjugated Antibodies | human |
| bsm-0387M-HRP | TNF-alpha (1F6) Antibody, HRP Conjugated | 0.1ml | 350 € | Bioss Primary Conjugated Antibodies | human |
| bsm-0387M-A350 | TNF-alpha (1F6) Monoclonal Antibody, ALEXA FLUOR 350 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bsm-0387M-A488 | TNF-alpha (1F6) Monoclonal Antibody, ALEXA FLUOR 488 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bsm-0387M-A555 | TNF-alpha (1F6) Monoclonal Antibody, ALEXA FLUOR 555 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bsm-0387M-A594 | TNF-alpha (1F6) Monoclonal Antibody, ALEXA FLUOR 594 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bsm-0387M-A647 | TNF-alpha (1F6) Monoclonal Antibody, ALEXA FLUOR 647 | 100ul | 332 € | Bioss Primary Conjugated Antibodies. | human |
| bsm-0387M | TNF-alpha (1F6) Monoclonal Antibody | 0.1ml | 263 € | Bioss Primary Unconjugated Antibodies | human |
| ENZ-006868-M01 | ADAM17 Mouse Monoclonal Antibody (M01), clone 1F6 | 0.1mg | 495 € | Zyagen | mouse |
| TRA-084254-M01 | CAMKK1 Mouse Monoclonal Antibody (M01), clone 1F6 | 0.1mg | 495 € | Zyagen | mouse |
| MEDORG103 | CD4, Clone: 1F6, Mouse Monoclonal antibody-Human; paraffin, IHC | 50 tests | 623 € | accurate-monoclonals | human |