Recombinant Human FAD-linked Sulfhydryl Oxidase ALR, GFER (N-6His)

Contact us
Catalog number: C700
Price: 2100 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human FAD-linked Sulfhydryl Oxidase ALR, GFER (N-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human GFER is produced by our E, coli expression system and the target gene encoding Met1-Asp125 is expressed with a 6His tag at the N-terminus
Molecular Weight: 17, 3 kD
UniProt number: P55789
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GFER (N-6His), FAD-linked Sulfhydryl Oxidase ALR
Short name: GFER (N-6His), Recombinant FAD-linked Sulfhydryl Oxidase ALR
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: GFER (N-6His), sapiens FAD-linked Sulfhydryl Oxidase ALR, recombinant H
Alternative technique: rec
Identity: 4236
Gene: GFER | More about : GFER
Long gene name: augmenter of liver regeneration , growth factor
Synonyms gene name: cerevisiae)-like (augmenter of liver regeneration) , erv1 (S, growth factor
Synonyms: HSS ERV1 ALR HERV1 HPO1 HPO2
Synonyms name: ERV1 homolog (S, cerevisiae) FAD-linked sulfhydryl oxidase ALR
Locus: 16p13, 3
Discovery year: 1997-03-19
GenBank acession: BC002429
Entrez gene record: 2671
Pubmed identfication: 8575761
RefSeq identity: NM_005262
Havana BLAST/BLAT: OTTHUMG00000176896

Related Products :

C700 Recombinant Human FAD-linked Sulfhydryl Oxidase ALR, GFER (N-6His) 50 µg 303 € novo human
bs-1576R-A350 FAD-linked sulfhydryl oxidase ALR Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1576R-A488 FAD-linked sulfhydryl oxidase ALR Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1576R-A555 FAD-linked sulfhydryl oxidase ALR Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1576R-A594 FAD-linked sulfhydryl oxidase ALR Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1576R-A647 FAD-linked sulfhydryl oxidase ALR Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1576R-Biotin FAD-linked sulfhydryl oxidase ALR Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1576R FAD-linked sulfhydryl oxidase ALR Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-1576R-Cy3 FAD-linked sulfhydryl oxidase ALR Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1576R-Cy5 FAD-linked sulfhydryl oxidase ALR Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1576R-Cy5.5 FAD-linked sulfhydryl oxidase ALR Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1576R-Cy7 FAD-linked sulfhydryl oxidase ALR Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1576R-FITC FAD-linked sulfhydryl oxidase ALR Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1576R-HRP FAD-linked sulfhydryl oxidase ALR Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
GENTAUR-58bb4402dbd1d African swine fever virus FAD-linked sulfhydryl oxidase (Ken-085) 100ug 1415 € MBS Recombinant Proteins human
GENTAUR-58bb440391ed1 African swine fever virus FAD-linked sulfhydryl oxidase (Ken-085) 1000ug 1415 € MBS Recombinant Proteins human
GENTAUR-58bb44045485c African swine fever virus FAD-linked sulfhydryl oxidase (Ken-085) 100ug 1923 € MBS Recombinant Proteins human
GENTAUR-58bb4404a1af2 African swine fever virus FAD-linked sulfhydryl oxidase (Ken-085) 1000ug 1923 € MBS Recombinant Proteins human
GENTAUR-58bd70e2e2fc9 Arabidopsis thaliana FAD-linked sulfhydryl oxidase ERV1 (ERV1) 100ug 1591 € MBS Recombinant Proteins human
GENTAUR-58bd70e338777 Arabidopsis thaliana FAD-linked sulfhydryl oxidase ERV1 (ERV1) 1000ug 1591 € MBS Recombinant Proteins human
GENTAUR-58bd70e385862 Arabidopsis thaliana FAD-linked sulfhydryl oxidase ERV1 (ERV1) 100ug 2105 € MBS Recombinant Proteins human
GENTAUR-58bd70e3cc716 Arabidopsis thaliana FAD-linked sulfhydryl oxidase ERV1 (ERV1) 1000ug 2105 € MBS Recombinant Proteins human
GENTAUR-58b3880cd29bd Saccharomyces cerevisiae Mitochondrial FAD-linked sulfhydryl oxidase ERV1 (ERV1) 100ug 1597 € MBS Recombinant Proteins human
GENTAUR-58b3880d1d299 Saccharomyces cerevisiae Mitochondrial FAD-linked sulfhydryl oxidase ERV1 (ERV1) 1000ug 1597 € MBS Recombinant Proteins human
GENTAUR-58b3880d5044d Saccharomyces cerevisiae Mitochondrial FAD-linked sulfhydryl oxidase ERV1 (ERV1) 100ug 2100 € MBS Recombinant Proteins human
GENTAUR-58b3880d83a70 Saccharomyces cerevisiae Mitochondrial FAD-linked sulfhydryl oxidase ERV1 (ERV1) 1000ug 2100 € MBS Recombinant Proteins human
GENTAUR-58b445fee8998 Saccharomyces cerevisiae Mitochondrial FAD-linked sulfhydryl oxidase ERV1 (ERV1) 100ug 1597 € MBS Recombinant Proteins human
GENTAUR-58b445ff63232 Saccharomyces cerevisiae Mitochondrial FAD-linked sulfhydryl oxidase ERV1 (ERV1) 1000ug 1597 € MBS Recombinant Proteins human
GENTAUR-58b445ffcc9ba Saccharomyces cerevisiae Mitochondrial FAD-linked sulfhydryl oxidase ERV1 (ERV1) 100ug 2100 € MBS Recombinant Proteins human
GENTAUR-58b446003fa5d Saccharomyces cerevisiae Mitochondrial FAD-linked sulfhydryl oxidase ERV1 (ERV1) 1000ug 2100 € MBS Recombinant Proteins human