Recombinant Human IL-6 Receptor Subunit α, IL-6RA, CD126 (C-6His)

Contact us
Catalog number: C691
Price: 735 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human IL-6 Receptor Subunit α, IL-6RA, CD126 (C-6His)
Quantity: 100ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interleukin-6 receptor alpha is produced by our Mammalian expression system and the target gene encoding Leu20-Asp358 is expressed with a 6His tag at the C-terminus
Molecular Weight: 38, 9 kD
UniProt number: P08887
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD126 (C-6His), IL-6RA, IL-6 Receptor Subunit &alpha
Short name: CD126 (C-6His), IL-6RA, Recombinant IL-6 Receptor Subunit &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: CD126 (C-6His), Interleukin-6RA, sapiens Interleukin-6 Receptor functionnal sequence &alpha, recombinant H
Alternative technique: rec
Identity: 6019
Gene: IL6R | More about : IL6R
Long gene name: interleukin 6 receptor
Synonyms: CD126
Locus: 1q21, 3
Discovery year: 2001-06-22
GenBank acession: X12830
Entrez gene record: 3570
RefSeq identity: NM_000565
Classification: CD molecules Immunoglobulin like domain containing Interleukin receptors
Havana BLAST/BLAT: OTTHUMG00000036073

Related Products :

C691 Recombinant Human IL-6 Receptor Subunit α, IL-6RA, CD126 (C-6His) 10 µg 156 € novo human
RP-0914H Recombinant Human IL6R / CD126 Protein (His Tag) 50μg 659 € adv human
RP-1365M Recombinant Mouse IL6RA / CD126 Protein (His Tag) 20μg 572 € adv mouse
RP-2186R Recombinant Rat IL-6R / CD126 Protein (ECD, His Tag) 20μg 572 € adv rat
RP-2185R Recombinant Rat IL-6R / CD126 Protein (Fc Tag, ECD) 20μg 508 € adv rat
GENTAUR-58be30e8b1236 IL 6 Receptor, gp80, endotoxin-free (CD126, IL-6R) 100ug 636 € MBS mono human
GENTAUR-58be30e931a9d IL 6 Receptor, gp80, endotoxin-free (CD126, IL-6R) Antibody 100ug 636 € MBS mono human
MBS619896 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX Receptor beta, LXRa, LXR-a, LXRalpha, LXRb, LXR-b, LXRbeta, NERI, NER-I, NR1H2, NR1H3, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 100ug 763 € MBS Polyclonals_1 human
MBS611189 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX receptor beta, LXRa, LXRalpha, LXRb, LXRbeta, NERI, NR1H2, NR1H3, Nuclear Orphan Receptor LXR alpha, Nuclear Orphan Receptor LXR beta, Nuclear Receptor Antibody 100ug 735 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
CEK1060 anti-Human CD126 ELISA Kit Antibody 96 Tests 703 € acr human
MBS551032 Anti-Human CD126 (IL6R) Polyclonal 200ug 475 € MBS Polyclonals_1 human
MBS551032 Anti-Human CD126 (IL6R) Polyclonal Antibody 100ug 359 € MBS Polyclonals_1 human
YSRTMCA822 CD126, IL-6R, gp80, Clone: B-R6, Mouse Monoclonal antibody-Human; frozen, IH/flow/ELISA/IP 0.1 mg 419 € accurate-monoclonals human
GENTAUR-58bde09643d5f MOUSE Anti-HUMAN CD126 (IL-6R) Antibody 100ug 464 € MBS mono human
AM31172AF-N anti-CD126 / IL6R Antibody 0,2 mg 442 € acr human
AM31173AF-N anti-CD126 / IL6R Antibody 0,2 mg 442 € acr human
AM31173FC-N anti-CD126 / IL6R Antibody 1ml (100T) 442 € acr human
AM31301AF-N anti-CD126 / IL6R Antibody 1 mg 1196 € acr human
AM31348BT-N anti-CD126 / IL6R Antibody 0,1 mg 717 € acr human
AM31357AF-N anti-CD126 / IL6R Antibody 0,2 mg 442 € acr human
AM31357FC-N anti-CD126 / IL6R Antibody 1ml (100T) 442 € acr human
AM31357PU-N anti-CD126 / IL6R Antibody 2ml (200T) 413 € acr human
AP31764PU-N anti-CD126 / IL6R Antibody 50 Вµl 732 € acr human
PA234 anti-CD126 / IL6R Antibody 5 Вµg 253 € acr human
PA234X anti-CD126 / IL6R Antibody 20 Вµg 384 € acr human
DM3568P anti-CD126 / IL6R (Extracell. Dom.) Antibody 0,1 mg 688 € acr human
GWB-5D091E CD126 antibody (IL-6R) 1 tube 550 € genways human
MBS421326 Goat anti-IL6R / CD126 (isoform 1) Antibody 100ug 299 € MBS Polyclonals_1 human
MBS620094 T-Complex Protein 1 alpha (T Complex Protein 1 alpha Subunit, T Complex Protein 1 Subunit alpha, TCP1 alpha, TCP1-alpha, TCP-1 alpha, CCT 1, CCT1, CCT alpha, CCTa, D6S230E, T Complex 1, T-complex 1, T Complex Locus TCP1, T-complex Locus TCP-1, T Complex P 100ug 735 € MBS Polyclonals_1 human