| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human ST8SIA1 is produced by our Mammalian expression system and the target gene encoding Tyr49-Ser356 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
2 kD, 36 |
| UniProt number: |
Q92185 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0, pH8 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ST8SIA1 (C-6His), &alpha, -2, -N-Acetylneuraminide &alpha, 8-Sialyltransferase |
| Short name: |
ST8SIA1 (C-6His), -2, -N-Acetylneuraminide &alpha, 8-Sialyltransferase, Recombinant &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
ST8SIA1 (C-6His), sapiens &alpha, -2, -N-Acetylneuraminide &alpha, 8-Sialyltransferase, recombinant H |
| Alternative technique: |
rec |
| Identity: |
10869 |
| Gene: |
ST8SIA1 |
More about : ST8SIA1 |
| Long gene name: |
ST8 alpha-N-acetyl-neuraminide alpha-2, 8-sialyltransferase 1 |
| Synonyms gene: |
SIAT8 SIAT8A |
| Synonyms gene name: |
GD3 synthase) A ST8 alpha-N-acetylneuraminate alpha-2, sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2, 8-sialyltransferase 1 , 8-sialytransferase |
| Synonyms name: |
ST8Sia I |
| Locus: |
12p12, 1 |
| Discovery year: |
1994-09-12 |
| GenBank acession: |
L32867 |
| Entrez gene record: |
6489 |
| Pubmed identfication: |
7901202 |
| RefSeq identity: |
NM_003034 |
| Classification: |
Sialyltransferases |
| Havana BLAST/BLAT: |
OTTHUMG00000169098 |