Recombinant Human Secretagoginn, SCGN (C-6His)

Contact us
Catalog number: C674
Price: 333 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human Secretagoginn, SCGN (C-6His)
Quantity: 0.1ml
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Secretagogin is produced by our Mammalian expression system and the target gene encoding Met1-Pro276 is expressed with a 6His tag at the C-terminus
Molecular Weight: 08 kD, 33
UniProt number: O76038
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SCGN (C-6His), Secretagoginn
Short name: SCGN (C-6His), Recombinant Secretagoginn
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SCGN (C-6His), sapiens Secretagoginn, recombinant H
Alternative technique: rec
Identity: 16941
Gene: SCGN | More about : SCGN
Long gene name: EF-hand calcium binding protein , secretagogin
Synonyms: SECRET DJ501N12, 8 SEGN CALBL
Synonyms name: calbindin-like
Locus: 6p22, 2
Discovery year: 2002-05-23
GenBank acession: BC000336
Entrez gene record: 10590
Pubmed identfication: 10811645
Classification: EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000014409

Related Products :

C674 Recombinant Human Secretagoginn, SCGN (C-6His) 500 µg 1613 € novo human
RP-1369H Recombinant Human SCGN / Secretagogin Protein (His Tag) 20μg 572 € adv human
GWB-P1316C SCGN, 1-276aa, Recombinant Protein bulk Ask price € genways bulk human
abx576417 Anti-Human Secretagogin (SCGN) ELISA Kit 96 tests 789 € abbex human
DL-SCGN-Hu Human Secretagogin SCGN ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bde6fad8013 Mouse Monoclonal [clone 2G7] (IgG1,k) to Human SCGN / Secretagogin Antibody 50ug 663 € MBS mono human
LV296684 SCGN Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
abx576414 Anti-Mouse Secretagogin (SCGN) ELISA Kit inquire 50 € abbex mouse
abx575955 Anti-Rat Secretagogin (SCGN) ELISA Kit 96 tests 833 € abbex rat
abx218452 Anti-SCGN Antibody 200 μg 369 € abbex human
GENTAUR-58be5ba8e1de1 Anti-SCGN/Secretagogin (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx904796 Anti-SCGN siRNA inquire 50 € abbex human
abx932591 Anti-SCGN siRNA 15 nmol 528 € abbex human
abx932592 Anti-SCGN siRNA inquire 50 € abbex human
AR09660PU-L anti-Secretagogin (SCGN) (1-276, His-tag) Antibody 0,25 mg 1138 € acr human
AR09660PU-N anti-Secretagogin (SCGN) (1-276, His-tag) Antibody 50 Вµg 485 € acr human
AM20984PU-N anti-Secretagogin (SCGN) (1-277) Antibody 50 Вµg 819 € acr human
DL-SCGN-Mu Mouse Secretagogin SCGN ELISA Kit 96T 921 € DL elisas mouse
DL-SCGN-Ra Rat Secretagogin SCGN ELISA Kit 96T 962 € DL elisas rat
GWB-MP113E SCGN antibody 1 vial 521 € genways human
GWB-MP114F SCGN antibody 1 vial 521 € genways human
MBS272604 SCGN antibody [N1C2] 100ul 426 € MBS Polyclonals_1 human
MBS270238 SCGN antibody [N2C3] 100ul 426 € MBS Polyclonals_1 human
PLA-010590-M01 SCGN Mouse Monoclonal Antibody (M01), clone 2G7 0.1mg 495 € Zyagen mouse
bs-11754R-A350 SCGN/Secretagogin Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11754R-A488 SCGN/Secretagogin Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11754R-A555 SCGN/Secretagogin Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11754R-A594 SCGN/Secretagogin Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11754R-A647 SCGN/Secretagogin Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11754R-Biotin SCGN/Secretagogin Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human