Recombinant Human Thioredoxin Domain-Containing Protein 12, TXNDC12, ERp18 (C-6His)

Contact us
Catalog number: C673
Price: 202 €
Supplier: novo
Product name: Recombinant Human Thioredoxin Domain-Containing Protein 12, TXNDC12, ERp18 (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human TXNDC12 is produced by our Mammalian expression system and the target gene encoding His27-Leu168 is expressed with a 6His tag at the C-terminus
Molecular Weight: 16, 98 kD
UniProt number: O95881
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ERp18 (C-6His), TXNDC12, Thioredoxin Domain Protein 12
Short name: ERp18 (C-6His), TXNDC12, Recombinant Thioredoxin Domain- Protein 12
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ERp18 (C-6His), TXNDC12, sapiens Thioredoxin Domain-Containing Protein 12, recombinant H
Alternative technique: rec
Identity: 24626
Gene: TXNDC12 | More about : TXNDC12
Long gene name: thioredoxin domain containing 12
Synonyms gene name: thioredoxin domain containing 12 (endoplasmic reticulum)
Synonyms: TLP19 ERP18 ERP19 hAG-1 AGR1 PDIA16
Synonyms name: 18 kDa anterior gradient homolog 1 (Xenopus laevis) protein disulfide isomerase family A, endoplasmic reticulum thioredoxin superfamily member, member 16
Locus: 1p32, 3
Discovery year: 2005-06-06
GenBank acession: AF131758
Entrez gene record: 51060
Pubmed identfication: 8619474 9110174
RefSeq identity: NM_015913
Classification: Protein disulfide isomerases
Havana BLAST/BLAT: OTTHUMG00000008629

Related Products :

C673 Recombinant Human Thioredoxin Domain-Containing Protein 12, TXNDC12, ERp18 (C-6His) 50 µg 496 € novo human
GENTAUR-58b87134e74ac Human Thioredoxin domain-containing protein 12 (TXNDC12) 100ug 1487 € MBS Recombinant Proteins human
GENTAUR-58b8713529d16 Human Thioredoxin domain-containing protein 12 (TXNDC12) 1000ug 1487 € MBS Recombinant Proteins human
GENTAUR-58b871358d5e2 Human Thioredoxin domain-containing protein 12 (TXNDC12) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58b87135df2dd Human Thioredoxin domain-containing protein 12 (TXNDC12) 1000ug 1989 € MBS Recombinant Proteins human
MBS619211 PR Set7 (SET8, SET Domain Containing 8, SET Domain-containing Protein 8, SET Domain Containing Lysine Methyltransferase 8, SET Domain-containing (Lysine Methyltransferase) 8, SETD8, H4 K20 Specific Histone Methyltransferase, H4-K20-HMTase SETD8, PR/SET Do Antibody 100ul 730 € MBS Polyclonals_1 human
CI27 Recombinant Human Thioredoxin Domain-Containing Protein 15, TXNDC15 (C-6His) 1 mg 2486 € novo human
MBS620347 SLP-76, NT (SH2 Domain Containing Leukocyte Protein 76 kD, SH2 Domain-containing Leukocyte Protein of 76kD, SH2 Domain Containing Leukocyte Protein of 76kDa, SLP76, SLP76 Tyrosine Phosphoprotein, SLP-76 Tyrosine Phosphoprotein, 76kD Tyrosine Phosphoprotei 100ug 763 € MBS Polyclonals_1 human
GWB-P0447E TXNDC12, 27-172aa, Recombinant Protein bulk Ask price € genways bulk human
MBS622587 SH2 domain protein 2A (SH2D2A, F2771, SCAP, SH2 domain-containing adapter protein, SH2 domain-containing protein 2A, T cell-specific adapter protein, TSAd, TSAD, VEGF receptor-associated protein, VRAP) 100ug 774 € MBS Polyclonals_1 human
MBS622108 GIPC3 (GIPC PDZ Domain Containing Family Member 3, PDZ Domain-containing Protein GIPC3, PDZ Domain Protein GIPC3) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS612590 Rabenosyn 5 (FYVE-finger-containing Rab5 Effector Protein Rabenosyn-5, Zinc Finger FYVE Domain Containing 20, Zinc Finger FYVE Domain-containing Protein 20, ZFYVE20) 100ug 735 € MBS Polyclonals_1 human
MBS619233 SH2D3A (SH2 Domain Containing 3A, Novel SH2-containing Protein 1, NSP1, SH2 Domain-containing Protein 3A, UNQ175/PRO201) 100ug 591 € MBS Polyclonals_1 human
MBS620754 PLEKHB1 (Pleckstrin homology domain containing, family B (evectins) member 1, KPL1, PHR1, PHRET1, PH domain containing protein in retina 1, PH domain containing, retinal 1) 100ug 591 € MBS Polyclonals_1 human
abx905880 Anti-TXNDC12 siRNA 30 nmol 717 € abbex human
abx938645 Anti-TXNDC12 siRNA inquire 50 € abbex human
abx938646 Anti-TXNDC12 siRNA 15 nmol 528 € abbex human
GWB-20D961 TXNDC12 Over-expression Lysate reagent 1 x 1 vial 463 € genways human
abx263286 Anti-Thioredoxin Domain Containing 12 Protein (Recombinant) 10 µg 340 € abbex human
abx260870 Anti-Thioredoxin Domain Containing 17 Protein (Recombinant) 1 mg 3559 € abbex human
CI22 Recombinant Human Coiled-Coil Domain-Containing Protein 134, CCDC134 (C-6His) 50 µg 303 € novo human
CI80 Recombinant Human CUB Domain-Containing Protein 1, CDCP1, CD318 (C-6His) 1 mg 2283 € novo human
C487 Recombinant Human Ly6, PLAUR Domain-Containing Protein 3, LYPD3, C4.4A (C-6His) 10 µg 131 € novo human
C981 Recombinant Human MANSC Domain-Containing Protein 1, MANSC1 (C-6His) 10 µg 202 € novo human
C529 Recombinant Human Plexin Domain-Containing Protein 1, PLXDC1 (C-6His) 50 µg 369 € novo human
CF35 Recombinant Human SH2 Domain-Containing Protein 1A, SH2D1A, SAP, DSHP (N-6His) 50 µg 303 € novo human
C548 Recombinant Human V-Set and Ig Domain-Containing Protein 2, VSIG2 (C-6His) 10 µg 131 € novo human
C549 Recombinant Human V-Set and Ig Domain-Containing Protein 4, VSIG4, CRIg (C-6His) 10 µg 121 € novo human
CP78 Recombinant Human V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-6His) 1 mg 2283 € novo human
CH34 Recombinant Human Zinc Finger and BTB Domain-Containing Protein 9, ZBTB9 (C-6His) 10 µg 202 € novo human