| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human TXNDC12 is produced by our Mammalian expression system and the target gene encoding His27-Leu168 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
16, 98 kD |
| UniProt number: |
O95881 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
10% Glycerol, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ERp18 (C-6His), TXNDC12, Thioredoxin Domain Protein 12 |
| Short name: |
ERp18 (C-6His), TXNDC12, Recombinant Thioredoxin Domain- Protein 12 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
ERp18 (C-6His), TXNDC12, sapiens Thioredoxin Domain-Containing Protein 12, recombinant H |
| Alternative technique: |
rec |
| Identity: |
24626 |
| Gene: |
TXNDC12 |
More about : TXNDC12 |
| Long gene name: |
thioredoxin domain containing 12 |
| Synonyms gene name: |
thioredoxin domain containing 12 (endoplasmic reticulum) |
| Synonyms: |
TLP19 ERP18 ERP19 hAG-1 AGR1 PDIA16 |
| Synonyms name: |
18 kDa anterior gradient homolog 1 (Xenopus laevis) protein disulfide isomerase family A, endoplasmic reticulum thioredoxin superfamily member, member 16 |
| Locus: |
1p32, 3 |
| Discovery year: |
2005-06-06 |
| GenBank acession: |
AF131758 |
| Entrez gene record: |
51060 |
| Pubmed identfication: |
8619474 9110174 |
| RefSeq identity: |
NM_015913 |
| Classification: |
Protein disulfide isomerases |
| Havana BLAST/BLAT: |
OTTHUMG00000008629 |