| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human ST6GalNAc2 is produced by our Mammalian expression system and the target gene encoding Ser29-Arg374 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
38, 84 kD |
| UniProt number: |
Q9UJ37 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ST6GalNAc2 (C-6His), ST6 Sialyltransferase 2 |
| Short name: |
ST6GalNAc2 (C-6His), Recombinant ST6 Sialyltransferase 2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
ST6GalNAc2 (C-6His), sapiens ST6 Sialyltransferase 2, recombinant H |
| Alternative technique: |
rec |
| Identity: |
6210 |
| Gene: |
CD82 |
More about : CD82 |
| Long gene name: |
CD82 molecule |
| Synonyms gene: |
ST6 KAI1 |
| Synonyms gene name: |
CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4)) CD82 antigen , kangai 1 (suppression of tumorigenicity 6, prostate |
| Synonyms: |
R2 IA4 TSPAN27 |
| Synonyms name: |
suppression of tumorigenicity 6 R2 leukocyte antigen |
| Locus: |
11p11, 2 |
| Discovery year: |
1994-01-10 |
| GenBank acession: |
U20770 |
| Entrez gene record: |
3732 |
| Classification: |
CD molecules Tetraspanins |
| Havana BLAST/BLAT: |
OTTHUMG00000166472 |