Recombinant Human Trefoil Factor 1, TFF1 (C-6His)

Contact us
Catalog number: C659
Price: Ask price €
Supplier: genways bulk
Product name: Recombinant Human Trefoil Factor 1, TFF1 (C-6His)
Quantity: bulk
Other quantities: 1 mg 2283€ 50 µg 278€ 500 µg 1471€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Trefoil Factor 1 is produced by our Mammalian expression system and the target gene encoding Glu25-Phe84 is expressed with a 6His at the C-terminus
Molecular Weight: 5 kD, 7
UniProt number: P04155
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEFHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TFF1 (C-6His), Trefoil Factor 1
Short name: TFF1 (C-6His), Recombinant Trefoil Factor 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: TFF1 (C-6His), sapiens Trefoil Factor 1, recombinant H
Alternative technique: rec
Identity: 11755
Gene: TFF1 | More about : TFF1
Long gene name: trefoil factor 1
Synonyms gene: BCEI
Synonyms gene name: breast cancer, estrogen-inducible sequence expressed in
Synonyms: D21S21 HPS2 pS2 pNR-2 HP1, A
Locus: 21q22, 3
Discovery year: 2001-06-22
GenBank acession: BC032811
Entrez gene record: 7031
Pubmed identfication: 9043862
RefSeq identity: NM_003225
Havana BLAST/BLAT: OTTHUMG00000086799

Related Products :

C659 Recombinant Human Trefoil Factor 1, TFF1 (C-6His) 500 µg 1471 € novo human
C660 Recombinant Mouse Trefoil Factor 1, TFF1 (C-6His) 10 µg 141 € novo mouse
TFF12-C Recombinant (E. coli) Human Trefoil factor 1 (TFF1) protein control for WB 100 μL 333 € adi human
abx574326 Anti-Human Trefoil Factor 1 (TFF1) ELISA Kit inquire 50 € abbex human
TFF12-P Human Trefoil factor 1 (TFF1) Control/blocking peptide #2 100 μg 188 € adi human
DL-TFF1-Hu Human Trefoil Factor 1 TFF1 ELISA Kit 96T 869 € DL elisas human
TFF12-A Rabbit Anti-Human Trefoil factor 1 (TFF1) IgG # 2 (aff pure) 100 μg 565 € adi human
abx576456 Anti-Rat Trefoil Factor 1 (TFF1) ELISA Kit 96 tests 804 € abbex rat
GENTAUR-58bdc2e65e3de Anti- Trefoil Factor 1 (TFF1) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdc71bd1112 Anti- Trefoil Factor 1 (TFF1) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc71c46cea Anti- Trefoil Factor 1 (TFF1) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bddc3665ac6 Anti- Trefoil Factor 1 (TFF1) Antibody 100ug 542 € MBS Polyclonals human
TFF11-P Mouse Trefoil factor 1 (TFF1) Control/blocking peptide #1 100 μg 188 € adi mouse
TFF11-A Rabbit Anti-Mouse Trefoil factor 1 (TFF1) IgG # 1 (aff pure) 100 μg 565 € adi mouse
GENTAUR-58bdbcea0db30 Rat Trefoil factor 1 (Tff1) 100ug 1266 € MBS Recombinant Proteins rat
GENTAUR-58bdbcea4f32c Rat Trefoil factor 1 (Tff1) 1000ug 1266 € MBS Recombinant Proteins rat
GENTAUR-58bdbcea961a7 Rat Trefoil factor 1 (Tff1) 100ug 1768 € MBS Recombinant Proteins rat
GENTAUR-58bdbceae5502 Rat Trefoil factor 1 (Tff1) 1000ug 1768 € MBS Recombinant Proteins rat
DL-TFF1-Ra Rat Trefoil Factor 1 TFF1 ELISA Kit 96T 962 € DL elisas rat
EKU07869 Trefoil Factor 1 (TFF1) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU07870 Trefoil Factor 1 (TFF1) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
C878 Recombinant Human Trefoil Factor 2, TFF2 (C-6His) 1 mg 2283 € novo human
C661 Recombinant Mouse Trefoil Factor 3, TFF3 (C-6His) 500 µg 1471 € novo mouse
GWB-P0909L TFF1, 25-84aa, Recombinant Protein bulk Ask price € genways bulk human
TFF22-C Recombinant (E. coli) Human Trefoil factor 2 (TFF2) protein control for WB 100 μL 333 € adi human
GWB-9772A0 Recombinant Human Trefoil Factor-1 bulk Ask price € genways bulk human
GWB-B8A582 Recombinant Human Trefoil Factor-1 His Tag bulk Ask price € genways bulk human
GWB-D8BB00 Recombinant Human Trefoil Factor-2 bulk Ask price € genways bulk human
GWB-1FEAB5 Recombinant Human Trefoil Factor-2 His Tag bulk Ask price € genways bulk human
GWB-4A447D Recombinant Human Trefoil Factor-3 bulk Ask price € genways bulk human