Recombinant Human Zymogen Granule Membrane Protein 16, ZG16 (C-6His)

Contact us
Catalog number: C654
Price: 393 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Zymogen Granule Membrane Protein 16, ZG16 (C-6His)
Quantity: 100ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Zymogen Granule Membrane Protein 16 is produced by our Mammalian expression system and the target gene encoding Asn17-Cys167 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17, 7 kD
UniProt number: O60844
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: NAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRCVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ZG16 (C-6His), Zymogen Granule Membrane Protein 16
Short name: ZG16 (C-6His), Recombinant Zymogen Granule Membrane Protein 16
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ZG16 (C-6His), sapiens Zymogen Granule Membrane Protein 16, recombinant H
Alternative technique: rec
Identity: 30961
Gene: ZG16 | More about : ZG16
Long gene name: zymogen granule protein 16
Synonyms gene: JCLN
Synonyms gene name: jacalin-like lectin domain containing zymogen granule protein 16 homolog (rat)
Synonyms: hZG16 JCLN1 ZG16A
Locus: 16p11, 2
Discovery year: 2009-01-05
GenBank acession: AK125559
Entrez gene record: 653808
Pubmed identfication: 21110947
RefSeq identity: NM_152338
Havana BLAST/BLAT: OTTHUMG00000177139

Related Products :

C654 Recombinant Human Zymogen Granule Membrane Protein 16, ZG16 (C-6His) 10 µg 156 € novo human
GENTAUR-58bb83ca44021 Human Zymogen granule membrane protein 16 (ZG16) 100ug 1498 € MBS Recombinant Proteins human
GENTAUR-58bb83ca970d1 Human Zymogen granule membrane protein 16 (ZG16) 1000ug 1498 € MBS Recombinant Proteins human
GENTAUR-58bb83cad0d6a Human Zymogen granule membrane protein 16 (ZG16) 100ug 2000 € MBS Recombinant Proteins human
GENTAUR-58bb83cb26395 Human Zymogen granule membrane protein 16 (ZG16) 1000ug 2000 € MBS Recombinant Proteins human
AE10512MO-48 ELISA test for Mouse Zymogen granule protein 16 homolog B (ZG16) 1x plate of 48 wells 373 € abebio mouse
AE10512MO Mouse Zymogen granule protein 16 homolog B (ZG16) ELISA Kit 96 wells plate 769 € ab-elisa elisas mouse
AE10512MO-96 Mouse Zymogen granule protein 16 homolog B (ZG16) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
abx167082 Anti-Glycoprotein 2, Zymogen Granule Membrane Protein (Recombinant) 100 μg 876 € abbex human
abx167466 Anti-Glycoprotein 2, Zymogen Granule Membrane Protein (Recombinant) 50 μg 644 € abbex human
abx168495 Anti-Glycoprotein 2, Zymogen Granule Membrane Protein (Recombinant) 50 μg 615 € abbex human
abx251491 Anti-Human Zymogen granule membrane protein 16 ELISA Kit 96 tests 659 € abbex human
MBS611714 Annexin A4 (Annexin IV, ANX4, ANXA4, Lipocortin IV, Placental Anticoagulant Protein II, Zymogen Granule Membrane-Associated Protein 36kD, ZAP36) 100ug 774 € MBS Polyclonals_1 human
abx128868 Anti-Glycoprotein 2, Zymogen Granule Membrane Antibody 10 μg 282 € abbex human
abx129700 Anti-Glycoprotein 2, Zymogen Granule Membrane Antibody 100 μg 528 € abbex human
abx130311 Anti-Glycoprotein 2, Zymogen Granule Membrane Antibody 50 μg 427 € abbex human
EKU04526 Glycoprotein 2, Zymogen Granule Membrane (GP2) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
DL-GP2-Ra Rat Glycoprotein 2, Zymogen Granule Membrane GP2 ELISA Kit 96T 962 € DL elisas rat
abx263238 Anti-Zymogen Granule Protein 16 Homolog Protein (Recombinant) 10 µg 340 € abbex human
abx165952 Anti-Zymogen Granule Protein 16 Homolog B (Recombinant) 50 μg 615 € abbex human
abx190382 Anti-Human Zymogen Granule Protein 16 Homolog B CLIA Kit inquire 50 € abbex human
abx251490 Anti-Human Zymogen granule protein 16 homolog B ELISA Kit 96 tests 659 € abbex human
DL-ZG16B-Hu Human Zymogen Granule Protein 16 Homolog B ZG16B ELISA Kit 96T 974 € DL elisas human
abx129284 Anti-Zymogen Granule Protein 16 Homolog B Antibody 10 μg 282 € abbex human
EKU08256 Zymogen Granule Protein 16 Homolog B (ZG16B) ELISA kit 1 plate of 96 wells 899 € Biomatik ELISA kits human
GWB-ATG0DD ZG16, 17-167aa Human, His tag, E.coli bulk Ask price € genways bulk human
LV363711 ZG16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
AR51439PU-N anti-ZG16 (17-167, His-tag) Antibody 0,1 mg 1109 € acr human
AR51439PU-S anti-ZG16 (17-167, His-tag) Antibody 20 Вµg 485 € acr human
GENTAUR-58be45b090c91 Anti- ZG16 Antibody 100ug 393 € MBS Polyclonals human