Recombinant Human Vitelline Membrane Outer Layer Protein 1 Homolog, VMO1 (C-6His)

Contact us
Catalog number: C650
Price: 1873 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Vitelline Membrane Outer Layer Protein 1 Homolog, VMO1 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human VMO1 is produced by our Mammalian expression system and the target gene encoding Gln25-Ser202 is expressed with a 6His tag at the C-terminus
Molecular Weight: 07 kD, 20
UniProt number: Q7Z5L0
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 0, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, 5 mM EDTA, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPGDDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFSLRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGACGLQTKIQGPRGLGDDTALNDARLFCCRSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: VMO1 (C-6His), Vitelline Membrane Outer Layer Protein 1 Homolog
Short name: VMO1 (C-6His), Recombinant Vitelline Membrane Outer Layer Protein 1 Homolog
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: VMO1 (C-6His), sapiens Vitelline Membrane Outer Layer Protein 1 Homolog, recombinant H
Alternative technique: rec
Identity: 30387
Gene: VMO1 | More about : VMO1
Long gene name: vitelline membrane outer layer 1 homolog
Synonyms gene name: vitelline membrane outer layer 1 homolog (chicken)
Locus: 17p13, 2
Discovery year: 2005-11-14
GenBank acession: AF521892
Entrez gene record: 284013
Pubmed identfication: 22025569
RefSeq identity: NM_182566
Havana BLAST/BLAT: OTTHUMG00000177898

Related Products :

C650 Recombinant Human Vitelline Membrane Outer Layer Protein 1 Homolog, VMO1 (C-6His) 50 µg 369 € novo human
GENTAUR-58bd635b295d2 Human Vitelline membrane outer layer protein 1 homolog (VMO1) 100ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd635b7adf0 Human Vitelline membrane outer layer protein 1 homolog (VMO1) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd635bba911 Human Vitelline membrane outer layer protein 1 homolog (VMO1) 100ug 2072 € MBS Recombinant Proteins human
GENTAUR-58bd635c0a962 Human Vitelline membrane outer layer protein 1 homolog (VMO1) 1000ug 2072 € MBS Recombinant Proteins human
GENTAUR-58be3dff8ea8a Anti- VMO1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be507a851cd Anti- VMO1 Antibody 0.2 mg 663 € MBS Polyclonals human
GENTAUR-58be507ae36b3 Anti- VMO1 Antibody 50ug 365 € MBS Polyclonals human
abx939458 Anti-VMO1 siRNA 15 nmol 528 € abbex human
abx939459 Anti-VMO1 siRNA 15 nmol 528 € abbex human
GWB-545ADF VMO1 Over-expression Lysate reagent 1 x 1 vial 562 € genways human
GENTAUR-58b9a70c9b489 Borrelia burgdorferi Flagellar filament outer layer protein (flaA) 100ug 1929 € MBS Recombinant Proteins human
GENTAUR-58b9a70d4695d Borrelia burgdorferi Flagellar filament outer layer protein (flaA) 1000ug 1929 € MBS Recombinant Proteins human
GENTAUR-58b9a70ddb82e Borrelia burgdorferi Flagellar filament outer layer protein (flaA) 100ug 2442 € MBS Recombinant Proteins human
GENTAUR-58b9a70e83acb Borrelia burgdorferi Flagellar filament outer layer protein (flaA) 1000ug 2442 € MBS Recombinant Proteins human
GENTAUR-58ba21beebaa3 Borrelia burgdorferi Flagellar filament outer layer protein (flaA) 100ug 1929 € MBS Recombinant Proteins human
GENTAUR-58ba21bf5f79e Borrelia burgdorferi Flagellar filament outer layer protein (flaA) 1000ug 1929 € MBS Recombinant Proteins human
GENTAUR-58ba21bfd7c8f Borrelia burgdorferi Flagellar filament outer layer protein (flaA) 100ug 2442 € MBS Recombinant Proteins human
GENTAUR-58ba21c03a78c Borrelia burgdorferi Flagellar filament outer layer protein (flaA) 1000ug 2442 € MBS Recombinant Proteins human
GENTAUR-58bd29becba11 Brachyspira hyodysenteriae Putative flagellar filament outer layer-like protein (flaAL) 100ug 1658 € MBS Recombinant Proteins human
GENTAUR-58bd29bf24fdb Brachyspira hyodysenteriae Putative flagellar filament outer layer-like protein (flaAL) 1000ug 1658 € MBS Recombinant Proteins human
GENTAUR-58bd29bf6bc4e Brachyspira hyodysenteriae Putative flagellar filament outer layer-like protein (flaAL) 100ug 2166 € MBS Recombinant Proteins human
GENTAUR-58bd29bf9f8f7 Brachyspira hyodysenteriae Putative flagellar filament outer layer-like protein (flaAL) 1000ug 2166 € MBS Recombinant Proteins human
GENTAUR-58ba01980903d Flagellar filament outer layer protein (flaA) 1000ug 1127 € MBS Recombinant Proteins human
GENTAUR-58ba019896c83 Flagellar filament outer layer protein (flaA) 1000ug 1630 € MBS Recombinant Proteins human
GENTAUR-58bc5da83c97f Flagellar filament outer layer protein (flaA) 100ug 1912 € MBS Recombinant Proteins human
GENTAUR-58bc5da88952c Flagellar filament outer layer protein (flaA) 1000ug 1912 € MBS Recombinant Proteins human
GENTAUR-58bc5da8bfcb8 Flagellar filament outer layer protein (flaA) 100ug 2426 € MBS Recombinant Proteins human
GENTAUR-58bc5da91586e Flagellar filament outer layer protein (flaA) 1000ug 2426 € MBS Recombinant Proteins human
GENTAUR-58bcb0c8646a3 Treponema hyodysenteriae Flagellar filament outer layer protein flaA1 (flaA1) 100ug 1873 € MBS Recombinant Proteins human