Recombinant Human Semenogelin-1, SEMG1 (C-6His)

Contact us
Catalog number: C638
Price: 521 €
Supplier: genways
Product name: Recombinant Human Semenogelin-1, SEMG1 (C-6His)
Quantity: 1 vial
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1471€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Semenogelin-1 is produced by our Mammalian expression system and the target gene encoding Gln24-Thr402 is expressed with a 6His tag at the C-terminus
Molecular Weight: 43, 8 kD
UniProt number: P04279
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 4, 2 um filtered solution of 20 mM Hac-NaAc, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDQNPLFTVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SEMG1 (C-6His), Semenogelin-1
Short name: SEMG1 (C-6His), Recombinant Semenogelin-1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SEMG1 (C-6His), sapiens Semenogelin-1, recombinant H
Alternative technique: rec
Identity: 10742
Gene: SEMG1 | More about : SEMG1
Long gene name: semenogelin I
Synonyms gene: SEMG
Synonyms: CT103
Synonyms name: semen coagulating protein cancer/testis antigen 103
Locus: 20q13, 12
Discovery year: 1991-09-13
Entrez gene record: 6406
Pubmed identfication: 2912989 15563730
RefSeq identity: NM_003007
Havana BLAST/BLAT: OTTHUMG00000032565

Related Products :

C638 Recombinant Human Semenogelin-1, SEMG1 (C-6His) 1 mg 2283 € novo human
abx571776 Anti-Human Semenogelin I (SEMG1) ELISA Kit 96 tests 789 € abbex human
DL-SEMG1-Hu Human Semenogelin I SEMG1 ELISA Kit 96T 904 € DL elisas human
AR50975PU-N anti-Semenogelin-1 (SEMG1) (24-462, His-tag) Antibody 0,5 mg 1109 € acr human
AR50975PU-S anti-Semenogelin-1 (SEMG1) (24-462, His-tag) Antibody 0,1 mg 485 € acr human
EKU07271 Semenogelin I (SEMG1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
GWB-ATG279 SEMG1, 24-462aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
abx168081 Anti-Semenogelin I Protein (Recombinant) 50 μg 572 € abbex human
abx261182 Anti-Semenogelin I Protein (Recombinant) 1 mg 3559 € abbex human
abx250766 Anti-Human Semenogelin-1 ELISA Kit 96 tests 659 € abbex human
abx250765 Anti-Human Semenogelin-2 ELISA Kit 96 tests 659 € abbex human
abx153055 Anti-Human Semenogelin I ELISA Kit inquire 50 € abbex human
abx153056 Anti-Human Semenogelin II ELISA Kit inquire 50 € abbex human
abx573103 Anti-Human Semenogelin II (SEMG2) ELISA Kit 96 tests 789 € abbex human
DL-SEMG2-Hu Human Semenogelin II SEMG2 ELISA Kit 96T 904 € DL elisas human
abx129235 Anti-Semenogelin I Antibody 10 μg 282 € abbex human
MBS276182 Semenogelin I antibody [N2C2], Internal 100ul 426 € MBS Polyclonals_1 human
EKU07272 Semenogelin II (SEMG2) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
MBS622096 Semenogelin II (SEMG2, SGII) Antibody 0.05 ml 531 € MBS Polyclonals_1 human
GENTAUR-58be10db92e83 Anti- SEMG1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be10dbe94a9 Anti- SEMG1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be451a7c6ec Anti- SEMG1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be545125cf2 Anti- SEMG1 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be5451a7d24 Anti- SEMG1 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be5452269eb Anti- SEMG1 Antibody 100ug 387 € MBS Polyclonals human
abx218552 Anti-SEMG1 Antibody inquire 50 € abbex human
abx932867 Anti-SEMG1 siRNA 30 nmol 717 € abbex human
GWB-53FE80 SEMG1 antibody 1 x 1 vial 411 € genways human
GWB-E50DFD SEMG1 antibody 1 vial 411 € genways human
GWB-MP038B SEMG1 antibody 1 vial 521 € genways human