| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human LYVE-1 is produced by our Mammalian expression system and the target gene encoding Leu20-Thr238 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
24, 6 kD |
| UniProt number: |
Q9Y5Y7 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 1 50 mM sodium chloride, 2 um filtered solution of 20 mM Tris-Citrate, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIRKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HAR, XLKD1 (C-6His), LYVE-1 |
| Short name: |
HAR, XLKD1 (C-6His), Recombinant LYVE-1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
HAR, XLKD1 (C-6His), sapiens LYVE-1, recombinant H |
| Alternative technique: |
rec |
| Identity: |
14687 |
| Gene: |
LYVE1 |
More about : LYVE1 |
| Long gene name: |
lymphatic vessel endothelial hyaluronan receptor 1 |
| Synonyms gene: |
XLKD1 |
| Synonyms gene name: |
extracellular link domain containing 1 |
| Synonyms: |
LYVE-1 |
| Locus: |
11p15, 4 |
| Discovery year: |
2001-03-21 |
| GenBank acession: |
AF118108 |
| Entrez gene record: |
10894 |
| Pubmed identfication: |
10037799 12554094 |
| RefSeq identity: |
NM_016164 |
| Havana BLAST/BLAT: |
OTTHUMG00000165713 |