| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are |
| Molecular Weight: |
25, 78 kD |
| UniProt number: |
Q6UXG3 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLNSTSAEDTSPALSSGSSKPRVSIPMVRVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD300LG (C-6His), CLM-9, CMRF35-Like Molecule 9 |
| Short name: |
CD300LG (C-6His), CLM-9, Recombinant CMRF35-Like Molecule 9 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD300 molecule-like family member g (C-6His), CLM-9, sapiens CMRF35-Like Molecule 9, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD300LG and IDBG-53022 and ENSG00000161649 and 146894, CD300LG and IDBG-640793 and ENSBTAG00000007434 and 615388, Cd300lg and IDBG-212432 and ENSMUSG00000017309 and 52685, Plasma membranes, protein binding, this GO :0001791 and IgM binding and molecular function this GO :0002376 and immune system process and biological process this GO :0002414 and immunoglobulin transcytosis in epithelial cells and biological process this GO :0005515 and protein binding and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016323 and basolateral plasma membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0032585 and multivesicular body membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0001791 : IgM binding, this GO :0001791 : IgM binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD300 molecule-like family member g |
| Identity: |
30455 |
| Gene: |
CD300LG |
More about : CD300LG |
| Long gene name: |
CD300 molecule like family member g |
| Synonyms gene name: |
CD300 antigen like family member G CD300 molecule-like family member g |
| Synonyms: |
Trem4 CLM9 |
| Synonyms name: |
nepmucin |
| Locus: |
17q21, 31 |
| Discovery year: |
2005-05-17 |
| GenBank acession: |
BC025395 |
| Entrez gene record: |
146894 |
| Pubmed identfication: |
16876123 16754720 |
| RefSeq identity: |
NM_145273 |
| Classification: |
V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000181796 |