Recombinant Human B- and T-Lymphocyte Attenuator, BTLA, CD272 (C-6His)

Contact us
Catalog number: C563
Price: 1752 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human B- and T-Lymphocyte Attenuator, BTLA, CD272 (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 10 µg 121€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human BTLA is produced by our Mammalian expression system and the target gene encoding Lys31-Leu150 is expressed with a 6His tag at the C-terminus
Molecular Weight: 14, 79 kD
UniProt number: Q7Z6A9
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BTLA, CD272 (C-6His), B T-Lymphocyte Attenuator
Short name: BTLA, CD272 (C-6His), Recombinant B- T-Lymphocyte Attenuator
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: B and T lymphocyte associated, CD272 (C-6His), sapiens B- and T-Lymphocyte Attenuator, recombinant H
Alternative technique: rec
Alternative to gene target: BTLA and IDBG-49858 and ENSG00000186265 and 151888, BTLA and IDBG-632288 and ENSBTAG00000011871 and 531767, Btla and IDBG-162900 and ENSMUSG00000052013 and 208154, Cell surfaces, protein binding, this GO :0002768 and immune response-regulating cell surface receptor signaling pathway and biological process this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0030889 and negative regulation of B cell proliferation and biological process this GO :0031295 and T cell costimulation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0046642 and negative regulation of alpha-beta T cell proliferation and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, B and T lymphocyte associated
Identity: 21087
Gene: BTLA | More about : BTLA
Long gene name: B and T lymphocyte associated
Synonyms: BTLA1 CD272
Locus: 3q13, 2
Discovery year: 2003-08-20
GenBank acession: AY293286
Entrez gene record: 151888
Pubmed identfication: 12796776
RefSeq identity: NM_181780
Classification: Immunoglobulin like domain containing CD molecules
Havana BLAST/BLAT: OTTHUMG00000159255

Related Products :

MBS619725 BTLA (B and T lymphocyte associated, BTLA1, CD272, FLJ16065, MGC129743, B and T lymphocyte attenuator) 100ug 547 € MBS Polyclonals_1 human
C563 Recombinant Human B- and T-Lymphocyte Attenuator, BTLA, CD272 (C-6His) 500 µg 1613 € novo human
CD06 Recombinant Human B- and T-Lymphocyte Attenuator, BTLA, CD272 (C-Fc) 1 mg 2486 € novo human
GENTAUR-58bd7ecbaa23f Rat B- and T-lymphocyte attenuator (Btla) 100ug 1509 € MBS Recombinant Proteins rat
GENTAUR-58bd7ecc0ff52 Rat B- and T-lymphocyte attenuator (Btla) 1000ug 1509 € MBS Recombinant Proteins rat
GENTAUR-58bd7ecc79649 Rat B- and T-lymphocyte attenuator (Btla) 100ug 2011 € MBS Recombinant Proteins rat
GENTAUR-58bd7ecce0cbe Rat B- and T-lymphocyte attenuator (Btla) 1000ug 2011 € MBS Recombinant Proteins rat
PRO-50024-0010 anti-CD272 / BTLA (25-289) Antibody 10 Вµg 268 € acr human
PRO-50024-0025 anti-CD272 / BTLA (25-289) Antibody 25 Вµg 413 € acr human
PRO-50024-0050 anti-CD272 / BTLA (25-289) Antibody 50 Вµg 616 € acr human
AM05617PU-L anti-CD272 / BTLA Antibody 0,2 mg 746 € acr human
AM05617PU-N anti-CD272 / BTLA Antibody 0,1 mg 456 € acr human
CP33 Recombinant Human Cytotoxic T-Lymphocyte Protein 4, CTLA-4, CD152 (C-6His) 10 µg 100 € novo human
CJ91 Recombinant Human Lymphocyte Activation Gene 3, LAG-3, CD223 (C-6His) 1 mg 1674 € novo human
CA64 Recombinant Human Lymphocyte Antigen 6H, LY6H (C-6His) 50 µg 496 € novo human
CH70 Recombinant Human Lymphocyte Cytosolic Protein 2, LCP2 (C-6His, N-T7 tag) 50 µg 496 € novo human
CC37 Recombinant Human T-lymphocyte Surface Antigen Ly-9, SLAMF3, CD229 (C-6His) 500 µg 1186 € novo human
MBS620004 BLAME (B-lymphocyte activator macrophage expressed, Lymphocyte Activator Macrophage Expressed, Slam family member 8, SLAM-8, SLAMF8) Antibody 100ug 564 € MBS Polyclonals_1 human
CP34 Recombinant Mouse Cytotoxic T-Lymphocyte Protein 4, CTLA-4, CD152 (C-6His) 50 µg 171 € novo mouse
CK56 Recombinant Mouse Lymphocyte Activation Gene 3, LAG-3, CD223 (C-6His) 1 mg 1674 € novo mouse
CS64 Recombinant Mouse T-lymphocyte Surface Antigen Ly-9, SLAMF3, CD229 (C-6His) 500 µg 1186 € novo mouse
CP56 Recombinant Rat T-lymphocyte Activation Antigen CD80, B7-1 (C-6His) 1 mg 2283 € novo rat
abx169579 Anti-BTLA Protein (Recombinant) 10 µg 311 € abbex human
RP-1055M Recombinant Mouse BTLA Protein (Fc Tag) 50μg 624 € adv mouse
RP-2016R Recombinant Rat BTLA Protein (ECD, Fc Tag) 50μg 624 € adv rat
RP-1018RC Recombinant Rhesus BTLA Protein (Fc Tag) 50μg 624 € adv rhesus
GENTAUR-58bd0555c51ca Bacillus subtilis Tryptophan RNA-binding attenuator protein inhibitory protein (rtpA) 100ug 1243 € MBS Recombinant Proteins human
GENTAUR-58bd055622b9f Bacillus subtilis Tryptophan RNA-binding attenuator protein inhibitory protein (rtpA) 1000ug 1243 € MBS Recombinant Proteins human
GENTAUR-58bd05567197e Bacillus subtilis Tryptophan RNA-binding attenuator protein inhibitory protein (rtpA) 100ug 1752 € MBS Recombinant Proteins human
GENTAUR-58bd0556ade49 Bacillus subtilis Tryptophan RNA-binding attenuator protein inhibitory protein (rtpA) 1000ug 1752 € MBS Recombinant Proteins human