Recombinant Human Anterior Gradient Protein 3 Homolog, AG-3, BCMP11, AGR3 (C-6His)

Contact us
Catalog number: C553
Price: 376 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Anterior Gradient Protein 3 Homolog, AG-3, BCMP11, AGR3 (C-6His)
Quantity: 50ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Anterior Gradient Protein 3 Homolog is produced by our Mammalian expression system and the target gene encoding Ile22-Leu166 is expressed with a 6His tag at the C-terminus
Molecular Weight: 04 kD, 18
UniProt number: Q8TD06
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 mM EDTA, pH 8, 2 um filtered solution of 20 mM TrisHCl, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSELVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: AG-3, AGR3 (C-6His), BCMP11, Anterior Gradient Protein 3 Homolog
Short name: AG-3, AGR3 (C-6His), BCMP11, Recombinant Anterior Gradient Protein 3 Homolog
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: AG-3, AGR3 (C-6His), BCMP11, sapiens Anterior Gradient Protein 3 Homolog, recombinant H
Alternative technique: rec
Identity: 24167
Gene: AGR3 | More about : AGR3
Long gene name: anterior gradient 3, protein disulphide isomerase family member
Synonyms gene name: anterior gradient 3 homolog (Xenopus laevis)
Synonyms: HAG3 hAG-3 BCMP11 PDIA18
Synonyms name: breast cancer membrane protein 11 protein disulfide isomerase family A, member 18
Locus: 7p21, 1
Discovery year: 2007-02-05
GenBank acession: AY069977
Entrez gene record: 155465
Pubmed identfication: 12592373 12477722
RefSeq identity: NM_176813
Classification: Protein disulfide isomerases
Havana BLAST/BLAT: OTTHUMG00000128411

Related Products :

C553 Recombinant Human Anterior Gradient Protein 3 Homolog, AG-3, BCMP11, AGR3 (C-6His) 50 µg 369 € novo human
MBS280003 Anti-Human Anterior Gradient Protein 3 (AGR3) PAb 100ug 536 € MBS Polyclonals_1 human
C424 Recombinant Human Anterior Gradient Protein 2 Homolog, AG-2, HPC8, AGR2 (C-6His) 10 µg 156 € novo human
RP-990 Recombinant (E.Coli, His-tag) Human Anterior Gradient Protein 2 Homolog 10 μg 260 € adi human
abx261426 Anti-Anterior Gradient Protein 2 Homolog Protein (Recombinant) 1 mg 3559 € abbex human
abx261381 Anti-Anterior Gradient Protein 3 Homolog Protein (Recombinant) 1 mg 3559 € abbex human
MBS620554 AGR2 (Anterior Gradient 2 Homolog (Xenopus laevis), AG2, GOB-4, HAG-2, XAG-2, Secreted Cement Gland Homolog) Antibody 100ug 707 € MBS Polyclonals_1 xenopus
GENTAUR-58ba8cd07b43b Human Anterior gradient protein 2 homolog (AGR2) 100ug 1509 € MBS Recombinant Proteins human
GENTAUR-58ba8cd12c452 Human Anterior gradient protein 2 homolog (AGR2) 1000ug 1509 € MBS Recombinant Proteins human
GENTAUR-58ba8cd1aadde Human Anterior gradient protein 2 homolog (AGR2) 100ug 2011 € MBS Recombinant Proteins human
GENTAUR-58ba8cd2812ed Human Anterior gradient protein 2 homolog (AGR2) 1000ug 2011 € MBS Recombinant Proteins human
GWB-431633 Anterior Gradient 2 (Xenepus Laevis) Homolog (AGR2) Rabbit antibody to or anti-Human Polyclonal (aa55-72) antibody 1 x 1 vial 602 € genways human
MBS618260 Anterior Gradient 2 (AG-2, AGR2, Secreted Cement Gland Protein XAG-2 Homolog, HPC8) Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58b8c0bee0397 Mouse Anterior gradient protein 2 homolog (Agr2) 100ug 1509 € MBS Recombinant Proteins mouse
GENTAUR-58b8c0bf48030 Mouse Anterior gradient protein 2 homolog (Agr2) 1000ug 1509 € MBS Recombinant Proteins mouse
GENTAUR-58b8c0bfb15e3 Mouse Anterior gradient protein 2 homolog (Agr2) 100ug 2011 € MBS Recombinant Proteins mouse
GENTAUR-58b8c0c00f2fc Mouse Anterior gradient protein 2 homolog (Agr2) 1000ug 2011 € MBS Recombinant Proteins mouse
GENTAUR-58b9c1398825e Mouse Anterior gradient protein 2 homolog (Agr2) 100ug 1509 € MBS Recombinant Proteins mouse
GENTAUR-58b9c139e9ea4 Mouse Anterior gradient protein 2 homolog (Agr2) 1000ug 1509 € MBS Recombinant Proteins mouse
GENTAUR-58b9c13a9aca4 Mouse Anterior gradient protein 2 homolog (Agr2) 100ug 2011 € MBS Recombinant Proteins mouse
GENTAUR-58b9c13c3f18c Mouse Anterior gradient protein 2 homolog (Agr2) 1000ug 2011 € MBS Recombinant Proteins mouse
MBS611899 AGR2 (Anterior Gradient 2 Homolog) Antibody 100ug 735 € MBS Polyclonals_1 human
abx570625 Anti-Human Anterior Gradient Protein 2 (AGR2) ELISA Kit inquire 50 € abbex human
abx190302 Anti-Human Anterior Gradient Protein 2 CLIA Kit 96 tests 1079 € abbex human
abx251981 Anti-Human Anterior Gradient Protein 2 ELISA Kit 96 tests 557 € abbex human
DL-AGR2-Hu Human Anterior Gradient Protein 2 AGR2 ELISA Kit 96T 904 € DL elisas human
EKU02439 Anterior Gradient Protein 2 (AGR2) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
PA20007RA Anterior Gradient Protein 3 antibody 100ug 618 € AbELISA Antibodies human
GENTAUR-58bdcc863ae25 Anti- Anterior Gradient Protein 2 (AGR2) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdccf55f4d1 Anti- Anterior Gradient Protein 2 (AGR2) Antibody 50ug 376 € MBS Polyclonals human